AP3S2 (NM_005829) Human Tagged ORF Clone

CAT#: RC201104

AP3S2 (Myc-DDK-tagged)-Human adaptor-related protein complex 3, sigma 2 subunit (AP3S2), transcript variant 1


  "NM_005829" in other vectors (4)

Reconstitution Protocol

USD 98.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "AP3S2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol AP3S2
Synonyms AP3S3; sigma3b
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC201104 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTCAGGCGATTCTGGTTTTCAACAACCATGGGAAGCCACGGCTAGTCCGCTTCTACCAGCGTTTCC
CAGAAGAAATTCAACAGCAGATTGTTCGAGAGACTTTCCATCTAGTCCTCAAGCGGGATGACAACATCTG
TAACTTCTTGGAGGGTGGAAGTTTGATTGGTGGCTCTGACTACAAACTGATCTACCGGCACTATGCTACC
CTCTACTTTGTATTTTGTGTGGATTCCTCAGAGAGTGAACTTGGAATCTTGGACCTCATCCAGGTTTTTG
TGGAAACTCTGGATAAGTGTTTCGAAAATGTGTGTGAATTGGATTTGATCTTCCATATGGATAAGGTGCA
CTACATCCTCCAGGAGGTGGTGATGGGTGGGATGGTGTTGGAAACAAACATGAATGAAATCGTGGCTCAG
ATTGAGGCTCAAAACAGGCTGGAGAAATCCGAGGGTGGCCTTTCAGCAGCCCCTGCGCGGGCTGTGTCTG
CTGTGAAAAACATCAACCTGCCAGAGATTCCTCGGAACATCAACATTGGCGATCTCAACATCAAAGTTCC
CAACCTGTCCCAGTTTGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201104 protein sequence
Red=Cloning site Green=Tags(s)

MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYAT
LYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQ
IEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005829
ORF Size 579 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005829.1, NM_005829.2, NM_005829.3, NM_005829.4, NP_005820.1
RefSeq Size 5934 bp
RefSeq ORF 582 bp
Locus ID 10239
Cytogenetics 15q26.1
Domains Clat_adaptor_s
Protein Pathways Lysosome
MW 22 kDa
Gene Summary Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. In concert with the BLOC-1 complex, AP-3 is required to target cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. [UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.