DNAJB6 (NM_005494) Human Tagged ORF Clone

CAT#: RC201620

DNAJB6 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily B, member 6 (DNAJB6), transcript variant 2

Product Images

Western blot validation of overexpression lysate (Cat# LY417262) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201620 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified DNAJB6 protein (Cat# TP301620). The protein was produced from HEK293T cells transfected with DNAJB6 cDNA clone (Cat# RC201620) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: DNAJB6
• Synonyms: DJ4; DnaJ; HHDJ1; HSJ-2; HSJ2; LGMD1D; LGMD1E; LGMDD1; MRJ; MSJ-1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201620 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGTGGATTACTATGAAGTTCTAGGCGTGCAGAGACATGCCTCACCCGAGGATATTAAAAAGGCATATC
  GGAAACTGGCACTGAAGTGGCATCCAGATAAAAATCCTGAGAATAAAGAAGAAGCAGAGAGAAAATTCAA
  GCAAGTAGCGGAGGCATATGAAGTGCTGTCGGATGCTAAGAAACGGGACATCTATGACAAATATGGCAAA
  GAAGGATTAAATGGTGGAGGAGGAGGTGGAAGTCATTTTGACAGTCCATTTGAATTTGGCTTCACATTCC
  GTAACCCAGATGATGTCTTCAGGGAATTTTTTGGTGGAAGGGACCCATTTTCATTTGACTTCTTTGAAGA
  CCCTTTTGAGGACTTCTTTGGGAATCGAAGGGGTCCCCGAGGAAGCAGAAGCCGAGGGACGGGGTCGTTT
  TTCTCTGCGTTCAGTGGATTTCCGTCTTTTGGAAGTGGATTTTCTTCTTTTGATACAGGATTTACTTCAT
  TTGGGTCACTAGGTCACGGGGGCCTCACTTCATTCTCTTCCACGTCATTTGGTGGTAGTGGCATGGGCAA
  CTTCAAATCGATATCAACTTCAACTAAAATGGTTAATGGCAGAAAAATCACTACAAAGAGAATTGTCGAG
  AACGGTCAAGAAAGAGTAGAAGTTGAAGAAGATGGCCAGTTAAAGTCCTTAACAATAAATGGTAAGGAGC
  AGCTGCTGCGCTTGGATAACAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201620 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVDYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGK
  EGLNGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPFEDFFGNRRGPRGSRSRGTGSF
  FSAFSGFPSFGSGFSSFDTGFTSFGSLGHGGLTSFSSTSFGGSGMGNFKSISTSTKMVNGRKITTKRIVE
  NGQERVEVEEDGQLKSLTINGKEQLLRLDNK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_005494
• ORF Size: 723 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_005494.1, NM_005494.2, NP_005485.1
• RefSeq Size: 1568 bp
• RefSeq ORF: 726 bp
• Locus ID: 10049
• Domains: DnaJ
• MW: 26.9 kDa
• Gene Summary: This gene encodes a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008]