H3.3B (H3F3B) (NM_005324) Human Tagged ORF Clone
CAT#: RC202257
H3F3B (Myc-DDK-tagged)-Human H3 histone, family 3B (H3.3B) (H3F3B)
"NM_005324" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | H3F3B |
Synonyms | H3.3B |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202257 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCCGAACCAAGCAGACTGCTCGTAAGTCCACCGGTGGGAAAGCCCCCCGCAAACAGCTGGCCACGA AAGCCGCCAGGAAAAGCGCTCCCTCTACCGGCGGGGTGAAGAAGCCTCATCGCTACAGGCCCGGGACCGT GGCGCTTCGAGAGATTCGTCGTTATCAGAAGTCGACCGAGCTGCTCATCCGGAAGCTGCCCTTCCAGAGG TTGGTGAGGGAGATCGCGCAGGATTTCAAAACCGACCTGAGGTTTCAGAGCGCAGCCATCGGTGCGCTGC AGGAGGCTAGCGAAGCGTACCTGGTGGGTCTGTTCGAAGATACCAACCTGTGTGCCATCCACGCTAAGAG AGTCACCATCATGCCCAAAGACATCCAGTTGGCTCGCCGGATACGGGGAGAGAGAGCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202257 protein sequence
Red=Cloning site Green=Tags(s) MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR LVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_005324 |
ORF Size | 408 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005324.1, NM_005324.2, NM_005324.3, NM_005324.4, NP_005315.1 |
RefSeq Size | 2753 bp |
RefSeq ORF | 411 bp |
Locus ID | 3021 |
Cytogenetics | 17q25.1 |
Domains | H3, histone |
Protein Pathways | Systemic lupus erythematosus |
MW | 15.3 kDa |
Gene Summary | 'Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is polyadenylated, unlike most histone genes. The protein encoded by this gene is a replication-independent histone that is a member of the histone H3 family. Pseudogenes of this gene have been identified on the X chromosome, and on chromosomes 5, 13 and 17. [provided by RefSeq, Oct 2015]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC116824 | H3F3B (untagged)-Human H3 histone, family 3B (H3.3B) (H3F3B) |
USD 310.00 |
|
RG202257 | H3F3B (GFP-tagged) - Human H3 histone, family 3B (H3.3B) (H3F3B) |
USD 460.00 |
|
RC202257L1 | Lenti ORF clone of Human H3 histone, family 3B (H3.3B) (H3F3B), Myc-DDK-tagged |
USD 768.00 |
|
RC202257L2 | Lenti ORF clone of Human H3 histone, family 3B (H3.3B) (H3F3B), mGFP tagged |
USD 620.00 |
|
RC202257L3 | Lenti ORF clone of Human H3 histone, family 3B (H3.3B) (H3F3B), Myc-DDK-tagged |
USD 620.00 |
|
RC202257L4 | Lenti ORF clone of Human H3 histone, family 3B (H3.3B) (H3F3B), mGFP tagged |
USD 768.00 |
{0} Product Review(s)
Be the first one to submit a review