CRSP9 (MED7) (NM_004270) Human Tagged ORF Clone

CAT#: RC202696

MED7 (Myc-DDK-tagged)-Human mediator complex subunit 7 (MED7), transcript variant 2


  "NM_004270" in other vectors (5)

Reconstitution Protocol

USD 98.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "MED7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MED7
Synonyms ARC34; CRSP9; CRSP33
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202696 representing NM_004270
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTGAACCACAGCAAGTGAGTGCACTTCCACCACCTCCAATGCAATATATCAAGGAATATACGGATG
AAAATATTCAAGAAGGCTTAGCTCCCAAGCCTCCCCCTCCAATAAAAGACAGTTACATGATGTTTGGCAA
TCAGTTCCAATGTGATGATCTTATCATCCGCCCTTTGGAAAGTCAGGGCATCGAACGGCTTCATCCTATG
CAGTTTGATCACAAGAAAGAACTGAGAAAACTTAATATGTCTATCCTTATTAATTTCTTGGACCTTTTAG
ATATTTTAATAAGGAGCCCTGGGAGTATAAAACGAGAAGAGAAACTAGAAGATCTTAAGCTGCTTTTTGT
ACACGTGCATCATCTTATAAATGAATACCGACCCCACCAAGCAAGAGAGACCTTGAGAGTCATGATGGAG
GTCCAGAAACGTCAACGGCTTGAAACAGCTGAGAGATTTCAAAAGCACCTGGAACGAGTAATTGAAATGA
TTCAGAATTGCTTGGCTTCTTTGCCTGATGATTTGCCTCATTCAGAAGCAGGAATGAGAGTAAAAACTGA
ACCAATGGATGCTGATGATAGCAACAATTGTACTGGACAGAATGAACATCAAAGAGAAAATTCAGGTCAT
AGGAGAGATCAGATTATAGAGAAAGATGCTGCCTTGTGTGTCCTAATTGATGAGATGAATGAAAGACCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202696 representing NM_004270
Red=Cloning site Green=Tags(s)

MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPM
QFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMME
VQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGH
RRDQIIEKDAALCVLIDEMNERP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004270
ORF Size 699 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004270.1, NM_004270.2, NM_004270.3, NM_004270.4, NP_004261.1
RefSeq Size 1066 bp
RefSeq ORF 702 bp
Locus ID 9443
Protein Families Druggable Genome, Transcription Factors
MW 27.1 kDa
Gene Summary The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.