Phospholamban (PLN) (NM_002667) Human Tagged ORF Clone
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | PLN |
Synonyms | CMD1P; CMH18; PLB |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC202712 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGAAAGTCCAATACCTCACTCGCTCAGCTATAAGAAGAGCCTCAACCATTGAAATGCCTCAACAAG CACGTCAAAAGCTACAGAATCTATTTATCAATTTCTGTCTCATCTTAATATGTCTCTTGCTGATCTGTAT CATCGTGATGCTTCTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202712 protein sequence
Red=Cloning site Green=Tags(s) MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002667 |
ORF Size | 156 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002667.1, NM_002667.2, NM_002667.3, NM_002667.4, NP_002658.1 |
RefSeq Size | 1742 bp |
RefSeq ORF | 159 bp |
Locus ID | 5350 |
Cytogenetics | 6q22.31 |
Protein Families | Transmembrane |
Protein Pathways | Calcium signaling pathway, Dilated cardiomyopathy |
MW | 6.1 kDa |
Gene Summary | 'The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure, and also familial hypertrophic cardiomyopathy. [provided by RefSeq, Apr 2016]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC118501 | PLN (untagged)-Human phospholamban (PLN) |
USD 310.00 |
|
RG202712 | PLN (GFP-tagged) - Human phospholamban (PLN) |
USD 460.00 |
|
RC202712L1 | Lenti ORF clone of Human phospholamban (PLN), Myc-DDK-tagged |
USD 768.00 |
|
RC202712L2 | Lenti ORF clone of Human phospholamban (PLN), mGFP tagged |
USD 620.00 |
|
RC202712L3 | Lenti ORF clone of Human phospholamban (PLN), Myc-DDK-tagged |
USD 768.00 |
|
RC202712L4 | Lenti ORF clone of Human phospholamban (PLN), mGFP tagged |
USD 768.00 |
{0} Product Review(s)
Be the first one to submit a review