C4BPB (NM_001017365) Human Tagged ORF Clone

CAT#: RC202799

C4BPB (Myc-DDK-tagged)-Human complement component 4 binding protein, beta (C4BPB), transcript variant 3


  "NM_001017365" in other vectors (4)

Reconstitution Protocol

USD 98.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "C4BPB"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol C4BPB
Synonyms C4BP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202799 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTTTTTGGTGTGCGTGCTGTCTTATGGTTGCGTGGCGAGTTTCTGCTTCAGATGAGCACTGTCCAG
AGCTTCCTCCAGTGGACAATAGCATATTTGTCGCAAAGGAGGTGGAAGGACAGATTCTGGGGACTTACGT
TTGTATCAAGGGCTACCACCTGGTAGGAAAGAAGACCCTTTTTTGCAATGCCTCTAAGGAGTGGGATAAC
ACCACTACTGAGTGCCGCTTGGGCCACTGTCCTGATCCTGTGCTGGTGAATGGAGAGTTCAGTTCTTCAG
GGCCTGTGAATGTAAGTGACAAAATCACGTTTATGTGCAATGACCACTACATCCTCAAGGGCAGCAATCG
GAGCCAGTGTCTAGAGGACCACACCTGGGCACCTCCCTTTCCCATCTGCAAAAGTAGGGACTGTGACCCT
CCTGGGAATCCAGTTCATGGCTATTTTGAAGGAAATAACTTCACCTTAGGATCCACCATTAGTTATTACT
GTGAAGACAGGTACTACTTAGTGGGCGTGCAGGAGCAGCAATGCGTTGATGGGGAGTGGAGCAGTGCACT
TCCAGTCTGCAAGTTGATCCAGGAAGCTCCCAAACCAGAGTGTGAGAAGGCACTTCTTGCCTTTCAGGAG
AGTAAGAACCTCTGCGAAGCCATGGAGAACTTTATGCAACAATTAAAGGAAAGTGGCATGACAATGGAGG
AGCTAAAATATTCTCTGGAGCTGAAGAAAGCTGAGTTGAAGGCAAAATTGTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202799 protein sequence
Red=Cloning site Green=Tags(s)

MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKTLFCNASKEWDN
TTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQCLEDHTWAPPFPICKSRDCDP
PGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPKPECEKALLAFQE
SKNLCEAMENFMQQLKESGMTMEELKYSLELKKAELKAKLL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001017365
ORF Size 459 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001017365.1, NM_001017365.2, NP_001017365.1
RefSeq Size 968 bp
RefSeq ORF 759 bp
Locus ID 725
Protein Pathways Complement and coagulation cascades
MW 28.3 kDa
Gene Summary This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.