Clathrin light chain (CLTB) (NM_001834) Human Tagged ORF Clone

CAT#: RC202954

CLTB (Myc-DDK-tagged)-Human clathrin, light chain B (CLTB), transcript variant 1

Product Images

Western blot validation of overexpression lysate (Cat# LY400697) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202954 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CLTB
• Synonyms: LCB
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202954 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGATGACTTTGGCTTCTTCTCGTCGTCGGAGAGCGGTGCCCCGGAGGCGGCGGAGGAGGACCCGG
  CGGCCGCCTTCCTGGCCCAGCAGGAGAGCGAGATTGCAGGCATAGAGAACGACGAGGGCTTCGGGGCACC
  TGCCGGCAGCCATGCGGCCCCCGCGCAGCCGGGCCCCACGAGTGGGGCTGGTTCTGAGGACATGGGGACC
  ACAGTCAATGGAGATGTGTTTCAGGAGGCCAACGGTCCTGCTGATGGCTACGCAGCCATTGCCCAGGCTG
  ACAGGCTGACCCAGGAGCCTGAGAGCATCCGCAAGTGGCGAGAGGAGCAGAGGAAACGGCTGCAAGAGCT
  GGATGCTGCATCTAAGGTCACGGAACAGGAATGGCGGGAGAAGGCCAAGAAGGACCTGGAGGAGTGGAAC
  CAGCGCCAGAGTGAACAAGTAGAGAAGAACAAGATCAACAACCGGGCATCCGAGGAGGCTTTCGTGAAGG
  AATCCAAGGAGGAGACCCCAGGCACAGAGTGGGAGAAGGTGGCCCAGCTATGTGACTTCAACCCCAAGAG
  CAGCAAGCAGTGCAAAGATGTGTCCCGCCTGCGCTCGGTGCTCATGTCCCTGAAGCAGACGCCACTGTCC
  CGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202954 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGT
  TVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAASKVTEQEWREKAKKDLEEWN
  QRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLS
  R
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001834
• ORF Size: 633 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001834.1, NM_001834.2, NM_001834.3, NP_001825.1
• RefSeq Size: 1226 bp
• RefSeq ORF: 636 bp
• Locus ID: 1212
• Cytogenetics: 5q35.2
• Domains: Clathrin_lg_ch
• Protein Pathways: Endocytosis, Huntington's disease, Lysosome
• MW: 23.2 kDa
• Gene Summary: 'Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]'