VIP (NM_003381) Human Tagged ORF Clone

CAT#: RC203126

VIP (Myc-DDK-tagged)-Human vasoactive intestinal peptide (VIP), transcript variant 1


  "NM_003381" in other vectors (7)

Reconstitution Protocol

USD 98.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol VIP
Synonyms PHM27
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203126 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACACCAGAAATAAGGCCCAGCTCCTTGTGCTCCTGACTCTTCTCAGTGTGCTCTTCTCACAGACTT
CGGCATGGCCTCTTTACAGGGCACCTTCTGCTCTCAGGTTGGGTGACAGAATACCCTTTGAGGGAGCAAA
TGAACCTGATCAAGTTTCATTAAAAGAAGACATTGACATGTTGCAAAATGCATTAGCTGAAAATGACACA
CCCTATTATGATGTATCCAGAAATGCCAGGCATGCTGATGGAGTTTTCACCAGTGACTTCAGTAAACTCT
TGGGTCAACTTTCTGCCAAAAAGTACCTTGAGTCTCTTATGGGAAAACGTGTTAGTAACATCTCAGAAGA
CCCTGTACCAGTCAAACGTCACTCAGATGCAGTCTTCACTGACAACTATACCCGCCTTAGAAAACAAATG
GCTGTAAAGAAATATTTGAACTCAATTCTGAATGGAAAGAGGAGCAGTGAGGGAGAATCTCCCGACTTTC
CAGAAGAGTTAGAAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203126 protein sequence
Red=Cloning site Green=Tags(s)

MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDT
PYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQM
AVKKYLNSILNGKRSSEGESPDFPEELEK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003381
ORF Size 2229 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003381.1, NM_003381.2, NM_003381.3, NP_003372.1
RefSeq Size 1601 bp
RefSeq ORF 513 bp
Locus ID 7432
Cytogenetics 6q25.2
Domains GLUCA
Protein Families Druggable Genome, Secreted Protein, Transmembrane
MW 19.1 kDa
Gene Summary 'The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Nov 2014]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.