NABP1 (NM_001031716) Human Tagged ORF Clone

CAT#: RC203672

NABP1 (Myc-DDK-tagged)-Human oligonucleotide/oligosaccharide-binding fold containing 2A (OBFC2A), transcript variant 1

Product Images

Western blot validation of overexpression lysate (Cat# LY422167) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203672 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: NABP1
• Synonyms: OBFC2A; SOSS-B2; SSB2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203672 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAATAGGGTCAACGACCCACTTATTTTTATAAGAGATATTAAGCCCGGACTGAAAAACTTAAATGTCG
  TCTTTATTGTCCTGGAGATAGGACGCGTGACCAAAACCAAAGACGGCCATGAAGTGAGATCGTGCAAAGT
  AGCAGATAAAACGGGCAGCATCACTATTTCCGTGTGGGATGAGATCGGAGGTCTTATACAGCCAGGGGAT
  ATTATTCGGTTGACCAGAGGGTATGCATCCATGTGGAAAGGATGTCTGACACTTTATACTGGAAGGGGTG
  GTGAACTTCAAAAAATTGGGGAATTTTGTATGGTTTATTCAGAAGTGCCAAATTTCAGTGAACCCAACCC
  AGATTATCGAGGACAGCAGAACAAAGGGGCACAGAGTGAACAGAAGAATAATTCCATGAATAGTAATATG
  GGTACAGGTACATTTGGACCAGTGGGAAATGGTGTTCACACTGGCCCTGAATCAAGGGAACACCAGTTTT
  CACATGCTGGCAGAAGCAATGGCCGGGGACTTATAAATCCACAACTACAAGGAACAGCTAGTAATCAAAC
  AGTGATGACCACAATAAGTAATGGCAGGGACCCTCGGAGAGCCTTTAAAAGA
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203672 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGD
  IIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNM
  GTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001031716
• ORF Size: 612 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001031716.1, NM_001031716.2, NP_001026886.1
• RefSeq Size: 3866 bp
• RefSeq ORF: 615 bp
• Locus ID: 64859
• Cytogenetics: 2q32.3
• MW: 22.4 kDa
• Gene Summary: Single-stranded DNA (ssDNA)-binding proteins, such as OBFC2A, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage (Richard et al., 2008 [PubMed 18449195]). [supplied by OMIM, Jun 2008]