AMPK beta 1 (PRKAB1) (NM_006253) Human Tagged ORF Clone

CAT#: RC203911

PRKAB1 (Myc-DDK-tagged)-Human protein kinase, AMP-activated, beta 1 non-catalytic subunit (PRKAB1)

Product Images

Western blot validation of overexpression lysate (Cat# LY416773) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC203911 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified PRKAB1 protein (Cat# TP303911). The protein was produced from HEK293T cells transfected with PRKAB1 cDNA clone (Cat# RC203911) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: PRKAB1
• Synonyms: AMPK; HAMPKb
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC203911 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGCAATACCAGCAGTGAGCGCGCCGCGCTGGAGCGGCATGGTGGCCATAAGACGCCCCGGAGGGACA
  GCTCGGGGGGCACCAAGGACGGGGACAGGCCCAAGATCCTGATGGACAGCCCCGAAGACGCCGACCTCTT
  CCACTCCGAGGAAATCAAGGCACCAGAGAAGGAGGAATTCCTGGCCTGGCAGCATGATCTGGAAGTGAAT
  GATAAAGCTCCCGCCCAGGCTCGGCCAACGGTGTTTCGATGGACGGGGGGCGGAAAGGAAGTTTACTTAT
  CTGGGTCCTTCAACAACTGGAGTAAACTTCCCCTCACCAGAAGCCACAATAACTTTGTAGCCATCCTGGA
  TCTGCCGGAAGGAGAGCATCAGTACAAGTTCTTTGTGGATGGTCAGTGGACGCACGACCCTTCCGAGCCC
  ATAGTAACCAGCCAGCTTGGCACAGTTAACAACATCATTCAAGTGAAGAAAACTGACTTTGAAGTATTTG
  ATGCTTTAATGGTGGATTCCCAAAAGTGCTCCGATGTGTCTGAGCTGTCCAGTTCTCCCCCAGGACCCTA
  CCATCAGGAGCCCTACGTCTGCAAACCCGAAGAGCGCTTTCGGGCACCCCCTATTCTCCCCCCACATCTC
  CTCCAGGTCATCCTGAACAAGGACACGGGGATTTCCTGTGATCCAGCTTTGCTTCCTGAGCCCAATCACG
  TCATGCTGAACCACCTATACGCGCTGTCTATCAAGGATGGAGTGATGGTGCTCAGCGCAACCCACCGGTA
  CAAGAAGAAGTACGTCACCACCTTGTTATACAAGCCCATA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC203911 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN
  DKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEP
  IVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHL
  LQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_006253
• ORF Size: 810 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_006253.1, NM_006253.2, NM_006253.3, NM_006253.4, NP_006244.2
• RefSeq Size: 2412 bp
• RefSeq ORF: 813 bp
• Locus ID: 5564
• Cytogenetics: 12q24.23
• Domains: isoamylase_N, AMPKBI
• Protein Families: Druggable Genome
• Protein Pathways: Adipocytokine signaling pathway, Hypertrophic cardiomyopathy (HCM), Insulin signaling pathway
• MW: 30.4 kDa
• Gene Summary: 'The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq, Jul 2008]'