NNT1 (CLCF1) (NM_013246) Human Tagged ORF Clone

CAT#: RC204427

CLCF1 (Myc-DDK-tagged)-Human cardiotrophin-like cytokine factor 1 (CLCF1), transcript variant 1

Product Images

Western blot validation of overexpression lysate (Cat# LY402229) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC204427 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified CLCF1 protein (Cat# TP304427). The protein was produced from HEK293T cells transfected with CLCF1 cDNA clone (Cat# RC204427) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CLCF1
• Synonyms: BSF-3; BSF3; CISS2; CLC; NNT-1; NNT1; NR6
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC204427 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGACCTCCGAGCAGGGGACTCGTGGGGGATGTTAGCGTGCCTGTGCACGGTGCTCTGGCACCTCCCTG
  CAGTGCCAGCTCTCAATCGCACAGGGGACCCAGGGCCTGGCCCCTCCATCCAGAAAACCTATGACCTCAC
  CCGCTACCTGGAGCACCAACTCCGCAGCTTGGCTGGGACCTATCTGAACTACCTGGGCCCCCCTTTCAAC
  GAGCCAGACTTCAACCCTCCCCGCCTGGGGGCAGAGACTCTGCCCAGGGCCACTGTTGACTTGGAGGTGT
  GGCGAAGCCTCAATGACAAACTGCGGCTGACCCAGAACTACGAGGCCTACAGCCACCTTCTGTGTTACTT
  GCGTGGCCTCAACCGTCAGGCTGCCACTGCTGAGCTGCGCCGCAGCCTGGCCCACTTCTGCACCAGCCTC
  CAGGGCCTGCTGGGCAGCATTGCGGGCGTCATGGCAGCTCTGGGCTACCCACTGCCCCAGCCGCTGCCTG
  GGACTGAACCCACTTGGACTCCTGGCCCTGCCCACAGTGACTTCCTCCAGAAGATGGACGACTTCTGGCT
  GCTGAAGGAGCTGCAGACCTGGCTGTGGCGCTCGGCCAAGGACTTCAACCGGCTCAAGAAGAAGATGCAG
  CCTCCAGCAGCTGCAGTCACCCTGCACCTGGGGGCTCATGGCTTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC204427 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFN
  EPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSL
  QGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQ
  PPAAAVTLHLGAHGF
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_013246
• ORF Size: 675 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_013246.1, NM_013246.2, NP_037378.1
• RefSeq Size: 1860 bp
• RefSeq ORF: 678 bp
• Locus ID: 23529
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
• MW: 25.2 kDa
• Gene Summary: This gene is a member of the glycoprotein (gp)130 cytokine family and encodes cardiotrophin-like cytokine factor 1 (CLCF1). CLCF1 forms a heterodimer complex with cytokine receptor-like factor 1 (CRLF1). This dimer competes with ciliary neurotrophic factor (CNTF) for binding to the ciliary neurotrophic factor receptor (CNTFR) complex, and activates the Jak-STAT signaling cascade. CLCF1 can be actively secreted from cells by forming a complex with soluble type I CRLF1 or soluble CNTFR. CLCF1 is a potent neurotrophic factor, B-cell stimulatory agent and neuroendocrine modulator of pituitary corticotroph function. Defects in CLCF1 cause cold-induced sweating syndrome 2 (CISS2). This syndrome is characterized by a profuse sweating after exposure to cold as well as congenital physical abnormalities of the head and spine. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2009]