beta Defensin 1 (DEFB1) (NM_005218) Human Tagged ORF Clone
CAT#: RC208244
DEFB1 (Myc-DDK-tagged)-Human defensin, beta 1 (DEFB1)
"NM_005218" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | DEFB1 |
Synonyms | BD1; DEFB-1; DEFB101; HBD1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC208244 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGAACTTCCTACCTTCTGCTGTTTACTCTCTGCTTACTTTTGTCTGAGATGGCCTCAGGTGGTAACT TTCTCACAGGCCTTGGCCACAGATCTGATCATTACAATTGCGTCAGCAGTGGAGGGCAATGTCTCTATTC TGCCTGCCCGATCTTTACCAAAATTCAAGGCACCTGTTACAGAGGGAAGGCCAAGTGCTGCAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC208244 protein sequence
Red=Cloning site Green=Tags(s) MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_005218 |
ORF Size | 204 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005218.1, NM_005218.2, NM_005218.3, NP_005209.1 |
RefSeq Size | 484 bp |
RefSeq ORF | 207 bp |
Locus ID | 1672 |
Cytogenetics | 8p23.1 |
Domains | Defensin_beta |
Protein Families | Secreted Protein |
MW | 7.4 kDa |
Gene Summary | 'Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC116851 | DEFB1 (untagged)-Human defensin, beta 1 (DEFB1) |
USD 310.00 |
|
RG208244 | DEFB1 (GFP-tagged) - Human defensin, beta 1 (DEFB1) |
USD 460.00 |
|
RC208244L1 | Lenti ORF clone of Human defensin, beta 1 (DEFB1), Myc-DDK-tagged |
USD 768.00 |
|
RC208244L2 | Lenti ORF clone of Human defensin, beta 1 (DEFB1), mGFP tagged |
USD 620.00 |
|
RC208244L3 | Lenti ORF clone of Human defensin, beta 1 (DEFB1), Myc-DDK-tagged |
USD 620.00 |
|
RC208244L4 | Lenti ORF clone of Human defensin, beta 1 (DEFB1), mGFP tagged |
USD 768.00 |
{0} Product Review(s)
Be the first one to submit a review