RAMP3 (NM_005856) Human Tagged ORF Clone

CAT#: RC208762

RAMP3 (Myc-DDK-tagged)-Human receptor (G protein-coupled) activity modifying protein 3 (RAMP3)


  "NM_005856" in other vectors (6)

Reconstitution Protocol

USD 98.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "RAMP3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RAMP3
Synonyms calcitonin receptor-like receptor activity modifying protein 3; receptor (calcitonin) activity modifying protein 3; receptor (G protein-coupled) activity modifying protein 3; receptor-activity-modifying protein 3; receptor activity modifying protein 3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208762 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACTGGAGCGCTGCGGCGCCCGCAACTTCTCCCGTTGCTGCTGCTGCTCTGCGGTGGGTGTCCCA
GAGCAGGCGGCTGCAACGAGACAGGCCTGTTGGAGAGGCTGCCCCTGTGTGGGAAGGCTTTCGCAGACAT
GATGGGCAAGGTGGACGTCTGGAAGTGGTGCAACCTGTCCGAGTTCATCGTGTACTATGAGAGTTTCACC
AACTGCACCGAGATGGAGGCCAATGTCGTGGGCTGCTACTGGCCCAACCCCCTGGCCCAGGGCTTCATCA
CCGGCATCCACAGGCAGTTCTTCTCCAACTGCACCGTGGACAGGGTCCACTTGGAGGACCCCCCAGACGA
GGTTCTCATCCCGCTGATCGTTATACCCGTCGTTCTGACTGTCGCCATGGCTGGCCTGGTGGTGTGGCGC
AGCAAACGCACCGACACGCTGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208762 protein sequence
Red=Cloning site Green=Tags(s)

METGALRRPQLLPLLLLLCGGCPRAGGCNETGLLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFT
NCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWR
SKRTDTLL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005856
ORF Size 444 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005856.1, NM_005856.2, NP_005847.1
RefSeq Size 1376 bp
RefSeq ORF 447 bp
Locus ID 10268
Protein Families Druggable Genome, Transmembrane
Protein Pathways Vascular smooth muscle contraction
MW 16.5 kDa
Gene Summary The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP3) protein, CRLR functions as an adrenomedullin receptor. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.