S100 Calcium Binding Protein A13 (S100A13) (NM_001024210) Human Tagged ORF Clone
CAT#: RC210001
S100A13 (Myc-DDK-tagged)-Human S100 calcium binding protein A13 (S100A13), transcript variant 1
"NM_001024210" in other vectors (5)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | S100A13 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210001 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGCAGAACCACTGACAGAGCTAGAGGAGTCCATTGAGACCGTGGTCACCACCTTCTTCACCTTTG CAAGGCAGGAGGGCCGGAAGGATAGCCTCAGCGTCAACGAGTTCAAAGAGCTGGTTACCCAGCAGTTGCC CCATCTGCTCAAGGATGTGGGCTCTCTTGATGAGAAGATGAAGAGCTTGGATGTGAATCAGGACTCGGAG CTCAAGTTCAATGAGTACTGGAGATTGATTGGGGAGCTGGCCAAGGAAATCAGGAAGAAGAAAGACCTGA AGATCAGGAAGAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210001 protein sequence
Red=Cloning site Green=Tags(s) MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSE LKFNEYWRLIGELAKEIRKKKDLKIRKK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001024210 |
ORF Size | 294 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001024210.1, NP_001019381.1 |
RefSeq Size | 951 bp |
RefSeq ORF | 297 bp |
Locus ID | 6284 |
Cytogenetics | 1q21.3 |
Protein Families | Druggable Genome |
MW | 11.5 kDa |
Gene Summary | 'The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC302232 | S100A13 (untagged)-Human S100 calcium binding protein A13 (S100A13), transcript variant 1 |
USD 420.00 |
|
SC321036 | S100A13 (untagged)-Human S100 calcium binding protein A13 (S100A13), transcript variant 1 |
USD 420.00 |
|
RG210001 | S100A13 (GFP-tagged) - Human S100 calcium binding protein A13 (S100A13), transcript variant 1 |
USD 460.00 |
|
RC210001L3 | Lenti-ORF clone of S100A13 (Myc-DDK-tagged)-Human S100 calcium binding protein A13 (S100A13), transcript variant 1 |
USD 620.00 |
|
RC210001L4 | Lenti-ORF clone of S100A13 (mGFP-tagged)-Human S100 calcium binding protein A13 (S100A13), transcript variant 1 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review