AP1S2 (NM_003916) Human Tagged ORF Clone

CAT#: RC210030

AP1S2 (Myc-DDK-tagged)-Human adaptor-related protein complex 1, sigma 2 subunit (AP1S2)

Product Images

Western blot validation of overexpression lysate (Cat# LY418354) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC210030 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: AP1S2
• Synonyms: DC22; MRX59; MRXS5; MRXS21; MRXSF; PGS; SIGMA1B
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC210030 representing NM_003916
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCAGTTTATGTTGCTTTTTAGTCGTCAGGGAAAGCTTCGACTGCAAAAATGGTATGTCCCACTATCAG
  ACAAAGAGAAGAAAAAGATCACAAGAGAACTTGTTCAGACCGTTTTAGCACGGAAACCTAAAATGTGCAG
  CTTCCTTGAGTGGCGAGATCTGAAGATTGTTTACAAAAGATATGCTAGTCTGTATTTTTGCTGTGCTATT
  GAGGATCAGGACAATGAACTAATTACCCTGGAAATAATTCATCGTTATGTGGAATTACTTGACAAGTATT
  TCGGCAGTGTCTGTGAACTAGATATCATCTTTAATTTTGAGAAGGCTTATTTTATTTTGGATGAGTTTCT
  TTTGGGAGGGGAAGTTCAGGAAACATCCAAGAAAAATGTCCTTAAAGCAATTGAGCAGGCTGATCTACTG
  CAGGAGGAAGCTGAAACCCCACGTAGTGTTCTTGAAGAAATTGGACTGACA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC210030 representing NM_003916
  Red=Cloning site Green=Tags(s)
  
  MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAI
  EDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLL
  QEEAETPRSVLEEIGLT
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_003916
• ORF Size: 471 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_003916.1, NM_003916.3, NM_003916.4, NP_003907.3
• RefSeq Size: 2283
• RefSeq ORF: 474
• Locus ID: 8905
• Domains: Clat_adaptor_s
• Protein Families: Druggable Genome
• Protein Pathways: Lysosome
• MW: 18.4 kDa
• Gene Summary: Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. Transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013]