Mitochondrial ribosomal protein L11 (MRPL11) (NM_170738) Human Tagged ORF Clone

CAT#: RC210613

MRPL11 (Myc-DDK-tagged)-Human mitochondrial ribosomal protein L11 (MRPL11), nuclear gene encoding mitochondrial protein, transcript variant 2

Product Images

Western blot validation of overexpression lysate (Cat# LY406858) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC210613 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified MRPL11 protein (Cat# TP310613). The protein was produced from HEK293T cells transfected with MRPL11 cDNA clone (Cat# RC210613) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: MRPL11
• Synonyms: CGI-113; L11MT; MRP-L11
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC210613 representing NM_170738
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCAAAGCTCGGCCGGGCCGCCCGGGGCCTCAGGAAGCCCGAGAGAGGCGTTTCCATCAACCAGTTTT
  GCAAGGAGTTCAATGAGAGGACAAAGGACATCAAGGAAGGCATTCCTCTGCCTACCAAGATTTTAGTGAA
  GCCTGACAGGACATTTGAAATTAAGATTGGACAGCCCACTGTTTCCTACTTCCTGAAGGCAGCAGCTGGG
  ATTGAAAAGGGGGCCCGGCAAACAGGGAAAGAGGTGGCAGGCCTGGTGACCTTGAAGCATGTGTATGAGA
  TTGCCCGCATCAAAGCTCAGGATGAGGCATTTGCCCTGCAGGATGTACCCCTGTCGTCTGTTGTCCGCTC
  CATCATCGGGTCTGCCCGTTCTCTGGGCATTCGCGTGGTGAAGGACCTCAGTTCAGAAGAGCTTGCAGCT
  TTCCAGAAGGAACGAGCCATCTTCCTGGCTGCTCAGAAGGAGGCAGATTTGGCTGCCCAAGAAGAAGCTG
  CCAAGAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC210613 representing NM_170738
  Red=Cloning site Green=Tags(s)
  
  MSKLGRAARGLRKPERGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAG
  IEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAA
  FQKERAIFLAAQKEADLAAQEEAAKK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_170738
• ORF Size: 498 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_170738.1, NM_170738.2, NM_170738.3, NP_733934.1
• RefSeq Size: 762
• RefSeq ORF: 501
• Locus ID: 65003
• MW: 18 kDa
• Gene Summary: This nuclear gene encodes a 39S subunit component of the mitochondial ribosome. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene are found on chromosomes 5 and 12. [provided by RefSeq, May 2014]