Gemin 2 (GEMIN2) (NM_003616) Human Tagged ORF Clone

CAT#: RC211219

GEMIN2 (Myc-DDK-tagged)-Human survival of motor neuron protein interacting protein 1 (SIP1), transcript variant alpha

Product Images

Western blot validation of overexpression lysate (Cat# LY418547) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC211219 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified GEMIN2 protein (Cat# TP311219). The protein was produced from HEK293T cells transfected with GEMIN2 cDNA clone (Cat# RC211219) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: GEMIN2
• Synonyms: SIP1; SIP1-delta
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC211219 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCGCCGAGCGGAACTGGCTGGTTTGAAAACCATGGCGTGGGTACCAGCGGAGTCCGCAGTGGAAGAGT
  TGATGCCTCGGCTATTGCCGGTAGAGCCTTGCGACTTGACGGAAGGTTTCGATCCCTCGGTACCCCCGAG
  GACGCCTCAGGAATACCTGAGGCGGGTCCAGATCGAAGCAGCTCAATGTCCAGATGTTGTGGTAGCTCAA
  ATTGACCCAAAGAAGTTGAAAAGGAAGCAAAGTGTGAATATTTCTCTTTCAGGATGCCAACCCGCCCCTG
  AAGGTTATTCCCCAACACTTCAATGGCAACAGCAACAAGTGGCACAGTTTTCAACTGTTCGACAGAATGT
  GAACAAACATAGAAGTCACTGGAAATCACAACAGTTGGATAGTAATGTGACAATGCCAAAATCTGAAGAT
  GAAGAAGGCTGGAAGAAATTTTGTCTGGGTGAAAAGTTATGTGCTGACGGGGCTGTTGGACCAGCCACAA
  ATGAAAGTCCTGGAATAGATTATGTACAAATTGGTTTTCCTCCCTTGCTTAGTATTGTTAGCAGAATGAA
  TCAGGCAACAGTAACTAGTGTCTTGGAATATCTGAGTAATTGGTTTGGAGAAAGAGACTTTACTCCAGAA
  TTGGGAAGATGGCTTTATGCTTTATTGGCTTGTCTTGAAAAGCCTTTGTTACCTGAGGCTCATTCACTGA
  TTCGGCAGCTTGCAAGAAGGTGCTCTGAAGTGAGGCTCTTAGTGGATAGCAAAGATGATGAGAGGGTTCC
  TGCTTTGAATTTATTAATCTGCTTGGTTAGCAGGTATTTTGACCAACGTGATTTAGCTGATGAGCCATCT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC211219 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRRAELAGLKTMAWVPAESAVEELMPRLLPVEPCDLTEGFDPSVPPRTPQEYLRRVQIEAAQCPDVVVAQ
  IDPKKLKRKQSVNISLSGCQPAPEGYSPTLQWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSED
  EEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQATVTSVLEYLSNWFGERDFTPE
  LGRWLYALLACLEKPLLPEAHSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_003616
• ORF Size: 840 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_003616.1, NM_003616.2, NP_003607.1
• RefSeq Size: 1368 bp
• RefSeq ORF: 843 bp
• Locus ID: 8487
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• MW: 31.6 kDa
• Gene Summary: This gene encodes one of the proteins found in the SMN complex, which consists of several gemin proteins and the protein known as the survival of motor neuron protein. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal snRNPs and for pre-mRNA splicing. This protein interacts directly with the survival of motor neuron protein and it is required for formation of the SMN complex. A knockout mouse targeting the mouse homolog of this gene exhibited disrupted snRNP assembly and motor neuron degeneration. [provided by RefSeq, Aug 2011]