HNMT (NM_001024074) Human Tagged ORF Clone
CAT#: RC211437
- TrueORF®
HNMT (Myc-DDK-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 2
"NM_001024074" in other vectors (4)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | HNMT |
Synonyms | HMT; HNMT-S1; HNMT-S2; MRT51 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC211437 representing NM_001024074
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCATCTTCCATGAGGAGCTTGTTTTCTGACCACGGGAAATATGTTGAATCTTTCCGGAGGTTTCTCA ACCATTCCACGGAACACCAGTGCATGCAGGAATTCATGGACAAGAAGCTGCCAGGCATAATAGGAAGATA CCAGAATTGCTGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC211437 representing NM_001024074
Red=Cloning site Green=Tags(s) MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRYQNCC myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001024074 |
ORF Size | 153 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001024074.1, NM_001024074.2, NP_001019245.1 |
RefSeq Size | 767 bp |
RefSeq ORF | 156 bp |
Locus ID | 3176 |
Cytogenetics | 2q22.1 |
Protein Families | Druggable Genome |
Protein Pathways | Histidine metabolism |
MW | 6 kDa |
Gene Summary | 'In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene. [provided by RefSeq, Jul 2008]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC302228 | HNMT (untagged)-Human histamine N-methyltransferase (HNMT), transcript variant 2 |
USD 420.00 |
|
RG211437 | HNMT (GFP-tagged) - Human histamine N-methyltransferase (HNMT), transcript variant 2 |
USD 460.00 |
|
RC211437L3 | Lenti-ORF clone of HNMT (Myc-DDK-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 2 |
USD 620.00 |
|
RC211437L4 | Lenti-ORF clone of HNMT (mGFP-tagged)-Human histamine N-methyltransferase (HNMT), transcript variant 2 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review