KRTAP4-1 (NM_033060) Human Tagged ORF Clone

CAT#: RC212062

KRTAP4 (Myc-DDK-tagged)-Human keratin associated protein 4-1 (KRTAP4-1)

Product Images

Western blot validation of overexpression lysate (Cat# LY409770) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC212062 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: KRTAP4-1
• Synonyms: KAP4.1; KAP4.10; KRTAP4-10; KRTAP4.10
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC212062 representing NM_033060
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGTTAACTCTTGTTGTGGCTCTGTCTGCTCTGACCAGGGCTGTGATCAAGGCCTCTGCCAAGAGACCT
  GCTGCCGCCCCAGCTGCTGCCAGACCACCTGTTGCTGCCCCAGCTGTGTTGTATCCAGCTGCTGCCGCCC
  ATCCTGCTCTCAGACTACCTGCTGCCAGACCACTTGCTGTCGCCCCAGCTGCTGCCGCCCAGTCTGTTGT
  CAGACCACCTGCCGCCCCAGCTGTGGTGTGTCCAGCTGCTGCCGTCCACTCTGTTGTCAGACCACCTGCC
  GCCCCAGCTGTGGTGTGTCCAGCTGCTGCCGTCCACTCTGCTGTCAGACCACCTGCTGCCGTACAACTTG
  CTGCCGCCCCAGCTGCTGTGGATCCTCTTGT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC212062 representing NM_033060
  Red=Cloning site Green=Tags(s)
  
  MVNSCCGSVCSDQGCDQGLCQETCCRPSCCQTTCCCPSCVVSSCCRPSCSQTTCCQTTCCRPSCCRPVCC
  QTTCRPSCGVSSCCRPLCCQTTCRPSCGVSSCCRPLCCQTTCCRTTCCRPSCCGSSC
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_033060
• ORF Size: 381 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_033060.1, NM_033060.2, NP_149049.1
• RefSeq Size: 754
• RefSeq ORF: 384
• Locus ID: 85285
• MW: 13.1 kDa
• Gene Summary: This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the ultrahigh sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq, Jul 2008]