AKAP14 (NM_001008535) Human Tagged ORF Clone

CAT#: RC212204

AKAP14 (Myc-DDK-tagged)-Human A kinase (PRKA) anchor protein 14 (AKAP14), transcript variant 3

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: AKAP14
• Synonyms: AKAP28; PRKA14
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC212204 representing NM_001008535
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGTGAGACTCAAAATTCAACAAGCCAGAAAGCAATGGATGAGGATAACAAAGCCGCAAGCCAAACAA
  TGCCGAATACACAAGACAAGAACTACGAGGATGAATTGACTCAAGTAGCTCTAGCTCTGGTTGAGGATGT
  CATCAATTATGCTGTTAAGATTGTGGAAGAGGAGCGAAACCCTTTGAAAAACATCAAGTGGATGACTCAC
  GGTGAATTCACTGTGGAAAAGGGTCTTAAACAAATTGACGAATATTTTTCGGTAAGT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC212204 representing NM_001008535
  Red=Cloning site Green=Tags(s)
  
  MSETQNSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAVKIVEEERNPLKNIKWMTH
  GEFTVEKGLKQIDEYFSVS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001008535
• ORF Size: 267 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001008535.1, NP_001008535.1
• RefSeq Size: 481
• RefSeq ORF: 270
• Locus ID: 158798
• Protein Families: Druggable Genome
• MW: 10 kDa
• Gene Summary: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The protein anchors PKA in ciliary axonemes and, in this way, may play a role in regulating ciliary beat frequency. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]