zinc finger protein 655 (ZNF655) (NM_001009958) Human Tagged ORF Clone

CAT#: RC212509

  • TrueORF®

ZNF655 (Myc-DDK-tagged)-Human zinc finger protein 655 (ZNF655), transcript variant 4


  "NM_001009958" in other vectors (4)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "ZNF655"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZNF655
Synonyms VIK; VIK-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC212509 representing NM_001009958
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAAATACCAGCCCAGGAAGCAGCAGGGTCACCAAGGGTCCAGTTTCAGTCTTTGGAGACCCAGT
CTGAGTGTCTGTCCCCAGAGCCTCAGTTTGTGCAGGACACCGACATGGAACAGGGACTCACTGGGGGCAT
ACTTCTCCGCCTTCCCACCACCCGGATTCATAGTGTGAATTCCTGCCCGGCCCTGAGTCATACCCAGGCA
AGTGCTTTCTCTGGAGAAACACTTGCCGTCCTTACAGCAGGAATCTCCAAGAGATGGCCCAAGTATCGGC
TTCCCATCGATATTGCTCGTCCCTGCTCGGAAACTCCTTTTCCACGATTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC212509 representing NM_001009958
Red=Cloning site Green=Tags(s)

MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGGILLRLPTTRIHSVNSCPALSHTQA
SAFSGETLAVLTAGISKRWPKYRLPIDIARPCSETPFPRL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001009958
ORF Size 330 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001009958.1, NP_001009958.1
RefSeq Size 1222
RefSeq ORF 333
Locus ID 79027
Protein Families Transcription Factors
MW 11.9 kDa
Gene Summary This gene encodes a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.