Antibodies

Jump to Filters
View as table Download
zinc finger protein 655 (ZNF655) Rabbit Polyclonal Antibody
TA345502

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-ZNF655 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF655 antibody: synthetic peptide directed towards the middle region of human ZNF655. Synthetic peptide located within the following region: EGSFSHSSDLILQQEVLTRQKAFDCDVWEKNSSQRAHLVQHQSIHTKENS
zinc finger protein 655 (ZNF655) Rabbit Polyclonal Antibody
TA345382

USD 410.00

5 Days

Rabbit Polyclonal Anti-ZNF655 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF655 antibody: synthetic peptide directed towards the N terminal of human ZNF655. Synthetic peptide located within the following region: MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGAPPVP
zinc finger protein 655 (ZNF655) Rabbit Polyclonal Antibody
TA333543

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ZNF655 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF655 Antibody is: synthetic peptide directed towards the N-terminal region of HUMAN ZNF655. Synthetic peptide located within the following region: QITISKETFTSEKNNECHEPEKSFSLDSTIDADQRVLRIQNTDDNDKYDM
zinc finger protein 655 (ZNF655) Rabbit Polyclonal Antibody
TA335476

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ZNF655 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF655 Antibody: synthetic peptide directed towards the N terminal of human ZNF655. Synthetic peptide located within the following region: QVPALPREGSPGDQAAALLTARYQEFVTFEDVAVHLTREEWGYLDPVQRD