zinc finger protein 655 (ZNF655) Rabbit Polyclonal Antibody

CAT#: TA333543

Rabbit Polyclonal Anti-ZNF655 Antibody

Product Images

Host: Rabbit; Target Name: ZNF655; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF655 Antibody is: synthetic peptide directed towards the N-terminal region of HUMAN ZNF655. Synthetic peptide located within the following region: QITISKETFTSEKNNECHEPEKSFSLDSTIDADQRVLRIQNTDDNDKYDM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: zinc finger protein 655
• Database Link:
  NP_612503
  Entrez Gene 79027 Human
  UniProt ID Q8N720
• Background: ZNF655 is a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions.
• Synonyms: VIK; VIK-1
• Note: Immunogen sequence homology: Human: 100%; Dog: 85%; Rat: 85%; Horse: 85%; Pig: 77%; Mouse: 77%; Guinea pig: 77%

Reference Data

• Protein Families: Transcription Factors