zinc finger protein 655 (ZNF655) Rabbit Polyclonal Antibody

CAT#: TA335476

Rabbit Polyclonal Anti-ZNF655 Antibody


USD 375.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "ZNF655"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZNF655 Antibody: synthetic peptide directed towards the N terminal of human ZNF655. Synthetic peptide located within the following region: QVPALPREGSPGDQAAALLTARYQEFVTFEDVAVHLTREEWGYLDPVQRD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 20 kDa
Gene Name zinc finger protein 655
Background ZNF655 is a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions.
Synonyms VIK; VIK-1
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 91%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.