zinc finger protein 655 (ZNF655) Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "ZNF655"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF655 antibody: synthetic peptide directed towards the N terminal of human ZNF655. Synthetic peptide located within the following region: MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGAPPVP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 54 kDa |
Gene Name | zinc finger protein 655 |
Database Link | |
Background | ZNF655 is a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions.This gene encodes a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Synonyms | VIK; VIK-1 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Guinea pig: 93%; Bovine: 86%; Rabbit: 86%; Dog: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.