MAX (NM_002382) Human Tagged ORF Clone
CAT#: RC213128
- TrueORF®
MAX (Myc-DDK-tagged)-Human MYC associated factor X (MAX), transcript variant 1
"NM_002382" in other vectors (6)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | MAX |
Synonyms | bHLHd4 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213128 representing NM_002382
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACA AACGGGCTCATCATAATGCACTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCG GGACTCAGTCCCATCACTCCAAGGAGAGAAGGCATCCCGGGCCCAAATCCTAGACAAAGCCACAGAATAT ATCCAGTATATGCGAAGGAAAAACCACACACACCAGCAAGATATTGACGACCTCAAGCGGCAGAATGCTC TTCTGGAGCAGCAAGTCCGTGCACTGGAGAAGGCGAGGTCAAGTGCCCAACTGCAGACCAACTACCCCTC CTCAGACAACAGCCTCTACACCAACGCCAAGGGCAGCACCATCTCTGCCTTCGATGGGGGCTCGGACTCC AGCTCGGAGTCTGAGCCTGAAGAGCCCCAAAGCAGGAAGAAGCTCCGGATGGAGGCCAGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213128 representing NM_002382
Red=Cloning site Green=Tags(s) MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEY IQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDS SSESEPEEPQSRKKLRMEAS myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_002382 |
ORF Size | 480 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002382.3, NM_002382.4, NP_002373.3 |
RefSeq Size | 2068 bp |
RefSeq ORF | 483 bp |
Locus ID | 4149 |
Cytogenetics | 14q23.3 |
Domains | HLH |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | MAPK signaling pathway, Pathways in cancer, Small cell lung cancer |
MW | 18.1 kDa |
Gene Summary | 'The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Mutations of this gene have been reported to be associated with hereditary pheochromocytoma. A pseudogene of this gene is located on the long arm of chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC111653 | MAX (untagged)-Human MYC associated factor X (MAX), transcript variant 1 |
USD 540.00 |
|
RG213128 | MAX (GFP-tagged) - Human MYC associated factor X (MAX), transcript variant 1 |
USD 570.00 |
|
RC213128L1 | Lenti-ORF clone of MAX (Myc-DDK-tagged)-Human MYC associated factor X (MAX), transcript variant 1 |
USD 720.00 |
|
RC213128L2 | Lenti-ORF clone of MAX (mGFP-tagged)-Human MYC associated factor X (MAX), transcript variant 1 |
USD 720.00 |
|
RC213128L3 | Lenti-ORF clone of MAX (Myc-DDK-tagged)-Human MYC associated factor X (MAX), transcript variant 1 |
USD 720.00 |
|
RC213128L4 | Lenti-ORF clone of MAX (mGFP-tagged)-Human MYC associated factor X (MAX), transcript variant 1 |
USD 720.00 |
{0} Product Review(s)
Be the first one to submit a review