GADD45B (NM_015675) Human Tagged ORF Clone

CAT#: RC213354

GADD45B (Myc-DDK-tagged)-Human growth arrest and DNA-damage-inducible, beta (GADD45B)


  "NM_015675" in other vectors (6)

Reconstitution Protocol

USD 98.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "GADD45B"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GADD45B
Synonyms GADD45BETA; MYD118
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213354 representing NM_015675
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGCTGGAAGAGCTCGTGGCGTGCGACAACGCGGCGCAGAAGATGCAGACGGTGACCGCCGCGGTGG
AGGAGCTTTTGGTGGCCGCTCAGCGCCAGGATCGCCTCACAGTGGGGGTGTACGAGTCGGCCAAGTTGAT
GAATGTGGACCCAGACAGCGTGGTCCTCTGCCTCTTGGCCATTGACGAGGAGGAGGAGGATGACATCGCC
CTGCAAATCCACTTCACGCTCATCCAGTCCTTCTGCTGTGACAACGACATCAACATCGTGCGGGTGTCGG
GCAATGCGCGCCTGGCGCAGCTCCTGGGAGAGCCGGCCGAGACCCAGGGCACCACCGAGGCCCGAGACCT
CCACTGTCTTCCCTTCCTACAGAACCCTCACACGGACGCCTGGAAGAGCCACGGCTTGGTGGAGGTGGCC
AGCTACTGCGAAGAAAGCCGGGGCAACAACCAGTGGGTCCCCTACATCTCTCTTCAGGAACGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213354 representing NM_015675
Red=Cloning site Green=Tags(s)

MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIA
LQIHFTLIQSFCCDNDINIVRVSGNARLAQLLGEPAETQGTTEARDLHCLPFLQNPHTDAWKSHGLVEVA
SYCEESRGNNQWVPYISLQER

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015675
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015675.1, NM_015675.2, NM_015675.3, NP_056490.1
RefSeq Size 1121 bp
RefSeq ORF 483 bp
Locus ID 4616
Cytogenetics 19p13.3
Domains Ribosomal_L7Ae
Protein Families Druggable Genome
Protein Pathways Cell cycle, MAPK signaling pathway, p53 signaling pathway
MW 17.6 kDa
Gene Summary 'This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. [provided by RefSeq, Jul 2008]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.