ANK1 (NM_020478) Human Tagged ORF Clone
CAT#: RC213698
- TrueORF®
ANK1 (Myc-DDK-tagged)-Human ankyrin 1, erythrocytic (ANK1), transcript variant 5
"NM_020478" in other vectors (4)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | ANK1 |
Synonyms | ANK; SPH1; SPH2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213698 representing NM_020478
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGGACTTTCGTCACCCAGCTGTTGGTCACGCTGGTGCTGCTGAGCTTCTTCCTGGTCAGCTGTCAGA ACGTGATGCACATTGTCAGGGGGTCCCTGTGCTTTGTGCTAAAGCACATCCACCAGGAGCTGGACAAGGA GCTGGGGGAGAGCGAGGGCCTCAGTGACGACGAGGAGACCATCTCCACCAGGGTGGTCCGGCGGCGGGTC TTCCTGAAGGGGAATGAGTTTCAGAATATTCCAGGGGAGCAGGTGACAGAGGAGCAATTCACGGATGAGC AGGGCAACATTGTCACCAAGAAGATCATTCGCAAGGTGGTTCGACAGATAGACTTGTCCAGCGCCGATGC CGCCCAGGAGCACGAGGAGGTGGAGCTGAGAGGGAGTGGCCTACAGCCGGACCTGATAGAGGGCAGGAAG GGGGCGCAGATAGTGAAGCGGGCCAGCCTGAAAAGGGGGAAACAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213698 representing NM_020478
Red=Cloning site Green=Tags(s) MWTFVTQLLVTLVLLSFFLVSCQNVMHIVRGSLCFVLKHIHQELDKELGESEGLSDDEETISTRVVRRRV FLKGNEFQNIPGEQVTEEQFTDEQGNIVTKKIIRKVVRQIDLSSADAAQEHEEVELRGSGLQPDLIEGRK GAQIVKRASLKRGKQ myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_020478 |
ORF Size | 465 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_020478.1, NM_020478.2, NM_020478.3, NM_020478.4, NP_065211.2 |
RefSeq Size | 3304 bp |
RefSeq ORF | 468 bp |
Locus ID | 286 |
Cytogenetics | 8p11.21 |
Protein Families | Transmembrane |
MW | 17.6 kDa |
Gene Summary | 'Ankyrins are a family of proteins that link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation, proliferation, contact and the maintenance of specialized membrane domains. Multiple isoforms of ankyrin with different affinities for various target proteins are expressed in a tissue-specific, developmentally regulated manner. Most ankyrins are typically composed of three structural domains: an amino-terminal domain containing multiple ankyrin repeats; a central region with a highly conserved spectrin binding domain; and a carboxy-terminal regulatory domain which is the least conserved and subject to variation. Ankyrin 1, the prototype of this family, was first discovered in the erythrocytes, but since has also been found in brain and muscles. Mutations in erythrocytic ankyrin 1 have been associated in approximately half of all patients with hereditary spherocytosis. Complex patterns of alternative splicing in the regulatory domain, giving rise to different isoforms of ankyrin 1 have been described. Truncated muscle-specific isoforms of ankyrin 1 resulting from usage of an alternate promoter have also been identified. [provided by RefSeq, Dec 2008]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC304777 | ANK1 (untagged)-Human ankyrin 1, erythrocytic (ANK1), transcript variant 5 |
USD 420.00 |
|
RG213698 | ANK1 (GFP-tagged) - Human ankyrin 1, erythrocytic (ANK1), transcript variant 5 |
USD 460.00 |
|
RC213698L3 | Lenti-ORF clone of ANK1 (Myc-DDK-tagged)-Human ankyrin 1, erythrocytic (ANK1), transcript variant 5 |
USD 620.00 |
|
RC213698L4 | Lenti-ORF clone of ANK1 (mGFP-tagged)-Human ankyrin 1, erythrocytic (ANK1), transcript variant 5 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review