MRPL52 (NM_180982) Human Tagged ORF Clone

CAT#: RC213844

MRPL52 (Myc-DDK-tagged)-Human mitochondrial ribosomal protein L52 (MRPL52), nuclear gene encoding mitochondrial protein, transcript variant 3

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: MRPL52
• Synonyms: mitochondrial ribosomal protein L52; OTTHUMP00000164489
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC213844 representing NM_180982
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGCTTTAGGGACTGTTCTCTTCAGTGTCCGGAGGCTGCACTGCAGCGTAGCCGCTTGGGCGGGCG
  GCCAGTGGCGACTACAGCAGGGACTGGCTGCCAACCCCTCCGGCTACGGGCCCCTTACCGAGCTCCCAGA
  CTGGTCATATGCGGATGGCCGCCCTGCTCCCCCAATGAAAGGCCAGCTTCGAAGAAAAGCTGAAAGGGAG
  ACGTTTGCAAGACGAGTTGTACTGCTGTCACAGGAAATGGACGCTGGATTACAAGCATGGCAGCTCAGGC
  AGCAGAAGTTGCAGGAAGAACAAAGGAAGCAGGAAAATGCTCTTAAACCCAAAGGGGCTTCACTGAAGAG
  CCCACTTCCAAGTCAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC213844 representing NM_180982
  Red=Cloning site Green=Tags(s)
  
  MAALGTVLFSVRRLHCSVAAWAGGQWRLQQGLAANPSGYGPLTELPDWSYADGRPAPPMKGQLRRKAERE
  TFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENALKPKGASLKSPLPSQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_180982
• ORF Size: 366 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_180982.1, NM_180982.2, NP_851313.1
• RefSeq Size: 1120
• RefSeq ORF: 369
• Locus ID: 122704
• MW: 13.6 kDa
• Gene Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which has no bacterial homolog. Multiple transcript variants encoding different protein isoforms were identified through sequence analysis. [provided by RefSeq, Jul 2008]