VTI1A (NM_145206) Human Tagged ORF Clone

CAT#: RC213934

VTI1A (Myc-DDK-tagged)-Human vesicle transport through interaction with t-SNAREs homolog 1A (yeast) (VTI1A)

Product Images

Western blot validation of overexpression lysate (Cat# LY407945) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC213934 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified VTI1A protein (Cat# TP313934). The protein was produced from HEK293T cells transfected with VTI1A cDNA clone (Cat# RC213934) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: VTI1A
• Synonyms: MMDS3; MVti1; Vti1-rp2; VTI1RP2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC213934 representing NM_145206
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCGTCCGACTTCGAAGGTTACGAGCAGGACTTCGCGGTGCTCACTGCAGAGATCACCAGCAAGATTG
  CGAGGGTCCCACGACTCCCGCCTGATGAAAAGAAACAGATGGTTGCAAATGTGGAGAAACAGCTTGAAGA
  AGCGAAAGAACTGCTTGAACAGATGGATTTGGAAGTCCGAGAGATACCACCCCAAAGTCGAGGGATGTAC
  AGCAACAGAATGAGAAGCTACAAACAAGAAATGGGAAAACTCGAAACAGATTTTAAAAGGTCACGGATCG
  CCTACAGTGACGAAGTACGGAATGAGCTCCTGGGGGATGATGGGAATTCCTCAGAGAACCAGAGGGCACA
  TCTGCTCGATAACACAGAGAGGCTGGAAAGGTCATCTCGGAGACTAGAGGCTGGATACCAAATAGCAGTG
  GAAACCGAGCAAATTGGTCAGGAGATGTTGGAAAACCTTAGTCATGACAGAGAAAAGATACAGCGAGCAC
  GTGAAAGACTTCGGGAAACAGATGCTAATTTGGGAAAAAGCTCCAGGATTCTGACAGGGATGTTGCGAAG
  AATCATCCAGAACCGCATCCTGCTCGTCATCCTAGGGATCATCGTGGTCATCACCATCCTGATGGCGATC
  ACTTTTTCTGTCAGAAGACAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC213934 representing NM_145206
  Red=Cloning site Green=Tags(s)
  
  MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVREIPPQSRGMY
  SNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDNTERLERSSRRLEAGYQIAV
  ETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRIIQNRILLVILGIIVVITILMAI
  TFSVRRH
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_145206
• ORF Size: 651 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_145206.2, NM_145206.3, NP_660207.2
• RefSeq Size: 4401 bp
• RefSeq ORF: 654 bp
• Locus ID: 143187
• Domains: V-SNARE
• Protein Families: Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport
• MW: 25 kDa
• Gene Summary: The protein encoded by this gene is a member of the family of soluble N-ethylmaleimide-sensitive fusion protein-attachment protein receptors (SNAREs) that function in intracellular trafficking. This family member is involved in vesicular transport between endosomes and the trans-Golgi network. It is a vesicle-associated SNARE (v-SNARE) that interacts with target membrane SNAREs (t-SNAREs). Polymorphisms in this gene have been associated with binocular function, and also with susceptibility to colorectal and lung cancers. A recurrent rearrangement has been found between this gene and the transcription factor 7-like 2 (TCF7L2) gene in colorectal cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]