CD89 (FCAR) (NM_133274) Human Tagged ORF Clone

CAT#: RC214534

  • TrueORF®

FCAR (Myc-DDK-tagged)-Human Fc fragment of IgA, receptor for (FCAR), transcript variant 6


  "NM_133274" in other vectors (4)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "FCAR"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol FCAR
Synonyms CD89; CTB-61M7.2; FcalphaRI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214534 representing NM_133274
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCCCAAACAGACCACCCTCCTGTGTCTTGGGGACTTTCCCATGCCTTTCATATCTGCCAAATCGA
GTCCTGTGATTCCCTTGGATGGATCTGTGAAAATCCAGTGCCAGGCCATTCGTGAAGCTTACCTGACCCA
GCTGATGATCATAAAAAACTCCACGTACCGAGAGATAGGCAGAAGACTGAAGTTTTGGAATGAGACTGAT
CCTGAGTTCGTCATTGACCACATGGACGCAAACAAGGCAGGGCGCTATCAGTGCCAATATAGGATAGGGC
ACTACAGATTCCGGTACAGTGACACCCTGGAGCTGGTAGTGACAGGCTTGTATGGCAAACCCTTCCTCTC
TGCAGATCGGGGTCTGGTGTTGATGCCAGGAGAGAATATTTCCCTCACGTGCAGCTCAGCACACATCCCA
TTTGATAGATTTTCACTGGCCAAGGAGGGAGAACTTTCTCTGCCACAGCACCAAAGTGGGGAACACCCGG
CCAACTTCTCTTTGGGTCCTGTGGACCTCAATGTCTCAGGGATCTACAGACTCCATCCACCAAGATTACA
CGACGCAGAACTTGATCCGCATGGCCGTGGCAGGACTGGTCCTCGTGGCTCTCTTGGCCATACTGGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214534 representing NM_133274
Red=Cloning site Green=Tags(s)

MDPKQTTLLCLGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETD
PEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIP
FDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRLHPPRLHDAELDPHGRGRTGPRGSLGHTG

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_133274
ORF Size 627 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_133274.1, NM_133274.2, NM_133274.3, NP_579808.1
RefSeq Size 1561 bp
RefSeq ORF 630 bp
Locus ID 2204
Cytogenetics 19q13.42
Protein Families Transmembrane
MW 23.4 kDa
Gene Summary 'This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.