VCY (NM_004679) Human Tagged ORF Clone

CAT#: RC215150

VCY (Myc-DDK-tagged)-Human variable charge, Y-linked (VCY)

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: VCY
• Synonyms: BPY1; VCY1; VCY1A
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC215150 representing NM_004679
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGTCCAAAGCCGAGAGCCTCGGGACCTCCGGCCAAGGCCAAGGAGACAGGAAAGAGGAAGTCCTCCT
  CTCAGCCGAGCCCCAGTGGCCCGAAGAAGAAGACTACCAAGGTGGCCGAGAAGGGAGAAGCAGTTCGTGG
  AGGGAGACGCGGGAAGAAAGGGGCTGCGACAAAGATGGCGGCCGTGACGGCACCTGAGGCGGAGAGCGGG
  CCAGCGGCACCCGGCCCCAGCGACCAGCCCAGCCAGGAGCTCCCTCAGCACGAGCTGCCGCCGGAGGAGC
  CAGTGAGCGAGGGGACCCAGCACGACCCCCTGAGTCAGGAGAGCGAGCTGGAGGAACCACTGAGTAAGGG
  GCGCCCATCTACTCCCCTATCTCCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC215150 representing NM_004679
  Red=Cloning site Green=Tags(s)
  
  MSPKPRASGPPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAESG
  PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSKGRPSTPLSP
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_004679
• ORF Size: 375 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_004679.1, NM_004679.2, NP_004670.1
• RefSeq Size: 551
• RefSeq ORF: 378
• Locus ID: 9084
• MW: 12.9 kDa
• Gene Summary: The protein encoded by this gene is a member of a family of human VCX/Y genes. This gene family has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. Members of the VCX/Y family share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. VCX/Y genes encode small and highly charged proteins of unknown function. This gene encodes a small, positively charged protein. The presence of a putative bipartite nuclear localization signal suggests that this gene encodes a nuclear protein. The genome has two identical copies of this gene within a palindromic region; this record represents the more centromeric copy. [provided by RefSeq, Jul 2008]