Integrin beta 4 binding protein (EIF6) (NM_181466) Human Tagged ORF Clone

CAT#: RC215237

EIF6 (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 6 (EIF6), transcript variant 4

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: EIF6
• Synonyms: b(2)gcn; CAB; eIF-6; EIF3A; ITGB4BP; p27(BBP); p27BBP
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC215237 representing NM_181466
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGTCCGAGCTTCGTTCGAGAACAACTGTGAGATCGGCTGCTTTGCCAAGCTCACCAACACCTACT
  GTCTGGTAGCGATCGGAGGCTCAGAGAACTTCTACAGGTGCGGCGGGAGCCCCGGGGCTTACGGTGGCGG
  GGAGGCGTGCGCAGGAGTCAAGAGCTCCGGCAGTGGGAGGGTGCCGGCCCCTCTGCCCCGCCACCACCGA
  GTCCATGTCCCTACAGTGTGTTCGAGGGCGAGCTCTCCGATACCATCCCCGTGGTGCACGCGTCTATCGC
  CGGCTGCCGCATCATCGGGCGCATGTGTGTGGGAGACAGAAGAAATTCTGGCAGATGTGCTCAAGGTGGA
  AGTCTTCAGACAGACAGTGGCCGACCAGGTGCTAGTAGGAAGCTACTGTGTCTTCAGCAATCAGGGAGGG
  CTGGTGCATCCCAAGACTTCAATTGAAGACCAGGATGAGCTGTCCTCTCTTCTTCAAGTCCCCCTTGTGG
  CGGGGACTGTGAACCGAGGCAGTGAGGTGATTGCTGCTGGGATGGTGGTGAATGACTGGTGTGCCTTCTG
  TGGCCTGGACACAACCAGCACAGAGCTGTCAGTGGTGGAGAGTGTCTTCAAGCTGAATGAAGCCCAGCCT
  AGCACCATTGCCACCAGCATGCGGGATTCCCTCATTGACAGCCTCACC
  
  ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGA
  TTACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC215237 representing NM_181466
  Red=Cloning site Green=Tags(s)
  
  MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYRCGGSPGAYGGGEACAGVKSSGSGRVPAPLPRHHR
  VHVPTVCSRASSPIPSPWCTRLSPAAASSGACVWETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGG
  LVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQP
  STIATSMRDSLIDSLT
  
  TRRLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-NotI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_181466
• ORF Size: 678 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_181466.1, NM_181466.2, NP_852131.1
• RefSeq Size: 1057 bp
• RefSeq ORF: 681 bp
• Locus ID: 3692
• Cytogenetics: 20q11.22
• Protein Families: Druggable Genome
• MW: 23.6 kDa
• Gene Summary: 'Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple non-protein coding transcript variants and variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2012]'