RNF98 (TRIM36) (NM_001017398) Human Tagged ORF Clone
CAT#: RC216219
- TrueORF®
TRIM36 (Myc-DDK-tagged)-Human tripartite motif containing 36 (TRIM36), transcript variant 3
"NM_001017398" in other vectors (4)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | TRIM36 |
Synonyms | ANPH; HAPRIN; RBCC728; RNF98 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC216219 representing NM_001017398
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCGGAGTCTGGGGAGATGAGTGAATTTGGCTACATCATGGAATTGATAGCTAAAGGCAAGGCTTCAG CAATGGGCCTGCAGCAAACCCATGAGCATTCCCGGTTGACTTCTAAAGGTGGAGAGGCCCGCTGTCCCTT TGAAATCTCTGAGGTTGGAAAGCAGTCTCTCCCAAGAAGAACT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC216219 representing NM_001017398
Red=Cloning site Green=Tags(s) MSESGEMSEFGYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRRT myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001017398 |
ORF Size | 183 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001017398.1, NP_001017398.1 |
RefSeq Size | 906 bp |
RefSeq ORF | 186 bp |
Locus ID | 55521 |
Cytogenetics | 5q22.3 |
Protein Families | Druggable Genome |
MW | 6.5 kDa |
Gene Summary | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC302036 | TRIM36 (untagged)-Human tripartite motif containing 36 (TRIM36), transcript variant 3 |
USD 420.00 |
|
RG216219 | TRIM36 (GFP-tagged) - Human tripartite motif containing 36 (TRIM36), transcript variant 3 |
USD 460.00 |
|
RC216219L3 | Lenti ORF clone of Human tripartite motif containing 36 (TRIM36), transcript variant 3, Myc-DDK-tagged |
USD 620.00 |
|
RC216219L4 | Lenti ORF clone of Human tripartite motif containing 36 (TRIM36), transcript variant 3, mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review