SDHAF1 (NM_001042631) Human Tagged ORF Clone
CAT#: RC216831
- TrueORF®
SDHAF1 (Myc-DDK-tagged)-Human succinate dehydrogenase complex assembly factor 1 (SDHAF1), nuclear gene encoding mitochondrial protein
"NM_001042631" in other vectors (6)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | SDHAF1 |
Synonyms | LYRM8 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC216831 representing NM_001042631
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCCGGCACAGCCGGCTGCAGAGGCAGGTTCTGAGCCTGTACCGCGATCTGCTGCGCGCCGGGCGTG GGAAGCCGGGCGCCGAGGCGCGAGTGCGGGCAGAGTTCCGGCAGCATGCGGGCCTGCCGCGGTCCGACGT GCTGCGCATCGAGTACCTGTACCGCCGCGGGCGGCGCCAGCTGCAGCTGCTACGCTCGGGCCACGCCACC GCCATGGGCGCCTTCGTACGCCCGCGGGCCCCGACCGGGGAGCCTGGCGGCGTGGGTTCCCAGCCTGACG ACGGCGACAGTCCAAGGAACCCCCACGACAGCACGGGGGCACCGGAGACCCGCCCCGACGGACGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC216831 representing NM_001042631
Red=Cloning site Green=Tags(s) MSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHAT AMGAFVRPRAPTGEPGGVGSQPDDGDSPRNPHDSTGAPETRPDGR myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001042631 |
ORF Size | 345 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001042631.1, NM_001042631.2, NP_001036096.1 |
RefSeq Size | 1131 bp |
RefSeq ORF | 348 bp |
Locus ID | 644096 |
Cytogenetics | 19q13.12 |
MW | 12.6 kDa |
Gene Summary | The succinate dehydrogenase (SDH) complex (or complex II) of the mitochondrial respiratory chain is composed of 4 individual subunits. The protein encoded by this gene resides in the mitochondria, and is essential for SDH assembly, but does not physically associate with the complex in vivo. Mutations in this gene are associated with SDH-defective infantile leukoencephalopathy (mitochondrial complex II deficiency). [provided by RefSeq, Mar 2010] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC311341 | SDHAF1 (untagged)-Human succinate dehydrogenase complex assembly factor 1 (SDHAF1), nuclear gene encoding mitochondrial protein |
USD 420.00 |
|
RG216831 | SDHAF1 (GFP-tagged) - Human succinate dehydrogenase complex assembly factor 1 (SDHAF1), nuclear gene encoding mitochondrial protein |
USD 460.00 |
|
RC216831L1 | Lenti ORF clone of Human succinate dehydrogenase complex assembly factor 1 (SDHAF1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged |
USD 768.00 |
|
RC216831L2 | Lenti ORF clone of Human succinate dehydrogenase complex assembly factor 1 (SDHAF1), nuclear gene encoding mitochondrial protein, mGFP tagged |
USD 620.00 |
|
RC216831L3 | Lenti ORF clone of Human succinate dehydrogenase complex assembly factor 1 (SDHAF1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged |
USD 620.00 |
|
RC216831L4 | Lenti ORF clone of Human succinate dehydrogenase complex assembly factor 1 (SDHAF1), nuclear gene encoding mitochondrial protein, mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review