BOLA3 (NM_001035505) Human Tagged ORF Clone

CAT#: RC217125

BOLA3 (Myc-DDK-tagged)-Human bolA homolog 3 (E. coli) (BOLA3), transcript variant 2

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: BOLA3
• Synonyms: MMDS2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC217125 representing NM_001035505
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGCATGGAGCCCGGCCGCGGCAGCGCCTCTCCTCCGCGGGATCCGCGGGCTTCCACTTCACCATC
  GGATGTTTGCCACTCAGACTGAGGGGGAGCTCAGAGTGACCCAAATTCTCAAAGAAAAGTTTCCACGAGC
  TACAGCTATAAAAGTCACTGACATTTCAGGCACTAAAAGAAGAAATCAAAGAGATGCATGGATTGCGGAT
  ATTTACCTCTGTCCCCAAACGCTGACCACGCCCTGGCTGCATAGATGCTGCTGCTTAAGACCTTGGATGA
  ACTTCACTGACATCATTCTTCCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC217125 representing NM_001035505
  Red=Cloning site Green=Tags(s)
  
  MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGTKRRNQRDAWIAD
  IYLCPQTLTTPWLHRCCCLRPWMNFTDIILP
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001035505
• ORF Size: 303 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001035505.1, NP_001030582.1
• RefSeq Size: 465
• RefSeq ORF: 306
• Locus ID: 388962
• Protein Families: Transcription Factors
• MW: 11.4 kDa
• Gene Summary: This gene encodes a protein that plays an essential role in the production of iron-sulfur (Fe-S) clusters for the normal maturation of lipoate-containing 2-oxoacid dehydrogenases, and for the assembly of the mitochondrial respiratory chain complexes. Mutation in this gene has been associated with multiple mitochondrial dysfunctions syndrome-2. Two alternatively spliced transcript variants encoding different isoforms with distinct subcellular localization have been reported for this gene (PMID:21944046). [provided by RefSeq, Dec 2011]