WDR9 (BRWD1) (NM_001007246) Human Tagged ORF Clone
CAT#: RC217768
- TrueORF®
BRWD1 (Myc-DDK-tagged)-Human bromodomain and WD repeat domain containing 1 (BRWD1), transcript variant 3
"NM_001007246" in other vectors (4)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | BRWD1 |
Synonyms | C21orf107; DCAF19; N143; WDR9; WRD9 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC217768 representing NM_001007246
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGAGCCGTCGTCCGCCCGACGCCCGGTGCCTCTCATCGAGTCGGAGCTGTACTTCCTTATCGCCC GGTACCTATCGGCGGGCCCGTGTCGGAGAGCGGCCCAGGTGCTGGTGCAGGAGCTGGAGCAGTACCAGTT GTTGCCGAAGAGATTGGACTGGGAGGGCAACGAGCACAACAGGAGCTACGAGGAGTTGGTCTTGTCCAAT AAGCATGTGGCTCCTGATCATCTTTTGCAAATCTGCCAGCGCATCGGTCCTATGTTGGATAAAGAAATTC CACCCAGTATTTCAAGAGTCACTTCTTTACTTGGTGCAGGAAGGCAGTCTTTGCTACGTACAGCAAAAGG TACCTTAATT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC217768 representing NM_001007246
Red=Cloning site Green=Tags(s) MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSN KHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001007246 |
ORF Size | 360 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001007246.1, NM_001007246.2, NP_001007247.1 |
RefSeq Size | 2653 bp |
RefSeq ORF | 363 bp |
Locus ID | 54014 |
Cytogenetics | 21q22.2 |
MW | 13.6 kDa |
Gene Summary | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) residues which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates multiple transcript variants encoding distinct isoforms. In mouse, this gene encodes a nuclear protein that has a polyglutamine-containing region that functions as a transcriptional activation domain which may regulate chromatin remodelling and associates with a component of the SWI/SNF chromatin remodelling complex. [provided by RefSeq, Jun 2011] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC301186 | BRWD1 (untagged)-Human bromodomain and WD repeat domain containing 1 (BRWD1), transcript variant 3 |
USD 420.00 |
|
RG217768 | BRWD1 (GFP-tagged) - Human bromodomain and WD repeat domain containing 1 (BRWD1), transcript variant 3 |
USD 460.00 |
|
RC217768L3 | Lenti-ORF clone of BRWD1 (Myc-DDK-tagged)-Human bromodomain and WD repeat domain containing 1 (BRWD1), transcript variant 3 |
USD 620.00 |
|
RC217768L4 | Lenti-ORF clone of BRWD1 (mGFP-tagged)-Human bromodomain and WD repeat domain containing 1 (BRWD1), transcript variant 3 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review