WDR9 (BRWD1) (NM_001007246) Human Tagged ORF Clone

CAT#: RG217768

  • TrueORF®

BRWD1 (GFP-tagged) - Human bromodomain and WD repeat domain containing 1 (BRWD1), transcript variant 3


  "NM_001007246" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "BRWD1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol BRWD1
Synonyms C21orf107; DCAF19; N143; WDR9; WRD9
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG217768 representing NM_001007246
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGCCGTCGTCCGCCCGACGCCCGGTGCCTCTCATCGAGTCGGAGCTGTACTTCCTTATCGCCC
GGTACCTATCGGCGGGCCCGTGTCGGAGAGCGGCCCAGGTGCTGGTGCAGGAGCTGGAGCAGTACCAGTT
GTTGCCGAAGAGATTGGACTGGGAGGGCAACGAGCACAACAGGAGCTACGAGGAGTTGGTCTTGTCCAAT
AAGCATGTGGCTCCTGATCATCTTTTGCAAATCTGCCAGCGCATCGGTCCTATGTTGGATAAAGAAATTC
CACCCAGTATTTCAAGAGTCACTTCTTTACTTGGTGCAGGAAGGCAGTCTTTGCTACGTACAGCAAAAGG
TACCTTAATT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG217768 representing NM_001007246
Red=Cloning site Green=Tags(s)

MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSN
KHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001007246
ORF Size 360 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001007246.2, NP_001007247.1
RefSeq Size 2653 bp
RefSeq ORF 363 bp
Locus ID 54014
Cytogenetics 21q22.2
Gene Summary This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD) residues which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 2 bromodomains and multiple WD repeats. This gene is located within the Down syndrome region-2 on chromosome 21. Alternative splicing of this gene generates multiple transcript variants encoding distinct isoforms. In mouse, this gene encodes a nuclear protein that has a polyglutamine-containing region that functions as a transcriptional activation domain which may regulate chromatin remodelling and associates with a component of the SWI/SNF chromatin remodelling complex. [provided by RefSeq, Jun 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.