Sterol carrier protein 2 (SCP2) (NM_001007250) Human Tagged ORF Clone
CAT#: RC217821
- TrueORF®
SCP2 (Myc-DDK-tagged)-Human sterol carrier protein 2 (SCP2), transcript variant 5
"NM_001007250" in other vectors (4)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | SCP2 |
Synonyms | NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC217821 representing NM_001007250
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAA GTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGATAAGAAGGCTGAC TGCACAATCACAATGGCTGACTCAGACTTCCTGGCTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC217821 representing NM_001007250
Red=Cloning site Green=Tags(s) MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEIRRLTAQSQWLTQTSWL myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001007250 |
ORF Size | 177 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001007250.1, NM_001007250.2, NP_001007251.1 |
RefSeq Size | 1298 bp |
RefSeq ORF | 180 bp |
Locus ID | 6342 |
Cytogenetics | 1p32.3 |
Protein Pathways | Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis |
MW | 6.7 kDa |
Gene Summary | 'This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms.[provided by RefSeq, Aug 2010]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC301190 | SCP2 (untagged)-Human sterol carrier protein 2 (SCP2), transcript variant 5 |
USD 420.00 |
|
RG217821 | SCP2 (GFP-tagged) - Human sterol carrier protein 2 (SCP2), transcript variant 5 |
USD 460.00 |
|
RC217821L3 | Lenti-ORF clone of SCP2 (Myc-DDK-tagged)-Human sterol carrier protein 2 (SCP2), transcript variant 5 |
USD 620.00 |
|
RC217821L4 | Lenti-ORF clone of SCP2 (mGFP-tagged)-Human sterol carrier protein 2 (SCP2), transcript variant 5 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review