Rabbit polyclonal SCP2 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-385 amino acids from the Central region of human SCP2. |
Rabbit polyclonal Anti-SCP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SCP2 antibody is: synthetic peptide directed towards the N-terminal region of Human SCP2. Synthetic peptide located within the following region: SSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQI |
Rabbit polyclonal Anti-SCP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCP2 antibody: synthetic peptide directed towards the middle region of human SCP2. Synthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) SCP2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) SCP2 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SCP2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SCP2 |
SCP2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-322 of human SCP2 (NP_001007099.1). |
| Modifications | Unmodified |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
SCP2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SCP2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SCP2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
SCP2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
SCP2 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SCP2 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SCP2 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
SCP2 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
