Sterol carrier protein 2 (SCP2) Rabbit Polyclonal Antibody
Other products for "SCP2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SCP2 antibody: synthetic peptide directed towards the middle region of human SCP2. Synthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 kDa |
Gene Name | sterol carrier protein 2 |
Database Link | |
Background | This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters.The transcript initiated fromThe proximal promoter encodesThe longer SCPx protein, andThe transcript initiated fromThe distal promoter encodesThe shorter SCP2 protein, withThe 2 proteins sharing a common C-terminus. Evidence suggests thatThe SCPx protein is a peroxisome-associated thiolase that is involved inThe oxidation of branched chain fatty acids, whileThe SCP2 protein is thought to be an intracellular lipid transfer protein.This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing ofThis gene produces multiple transcript variants, some encoding different isoforms. [provided by RefSeq, Aug 2010] |
Synonyms | NLTP; NSL-TP; SCP-2; SCP-CHI; SCP-X; SCPX |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93% |
Reference Data | |
Protein Pathways | Metabolic pathways, PPAR signaling pathway, Primary bile acid biosynthesis |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.