QRFP (NM_198180) Human Tagged ORF Clone

CAT#: RC218501

QRFP (Myc-DDK-tagged)-Human pyroglutamylated RFamide peptide (QRFP)

Product Images

Western blot validation of overexpression lysate (Cat# LY404880) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC218501 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: QRFP
• Synonyms: 26RFa; P518
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC218501 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGTAAGGCCTTACCCCCTGATCTACTTCCTCTTCCTGCCGCTGGGCGCCTGCTTCCCTCTACTGGACA
  GAAGAGAGCCCACAGACGCCATGGGTGGCCTCGGAGCTGGAGAACGCTGGGCCGACCTGGCCATGGGGCC
  CCGACCCCACTCCGTGTGGGGTTCCTCTCGGTGGCTGAGAGCTTCACAGCCACAGGCCCTGCTTGTCATA
  GCCAGGGGGCTGCAGACATCGGGCAGAGAGCATGCTGGCTGCAGATTCCGCTTCGGGAGGCAGGACGAAG
  GCAGTGAGGCCACCGGCTTCCTCCCTGCTGCGGGGGAGAAGACCAGCGGCCCGTTAGGGAACCTGGCTGA
  GGAGCTCAATGGCTACAGCAGGAAGAAAGGCGGCTTCAGCTTCCGCTTCGGTCGGCGG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC218501 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLRASQPQALLVI
  ARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELNGYSRKKGGFSFRFGRR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_198180
• ORF Size: 408 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_198180.1, NM_198180.2, NP_937823.1
• RefSeq Size: 411 bp
• RefSeq ORF: 411 bp
• Locus ID: 347148
• MW: 14.9 kDa
• Gene Summary: This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. The encoded products are members of the RFamide family of neuropeptides, characterized by their common protein C-terminus consisting of an arginine (R) and an amidated phenylalanine (F). These products include the neuropeptides 26RFa and the N-terminally extended form, 43RFa. Both of these neuropeptides bind to the pyroglutamylated RFamide peptide receptor (QRFPR) and may regulate blood pressure, reproduction and food intake in rodents. [provided by RefSeq, Jul 2015]