LYNX1 (NM_177457) Human Tagged ORF Clone

CAT#: RC218661

LYNX1 (Myc-DDK-tagged)-Human Ly6/neurotoxin 1 (LYNX1), transcript variant 3

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: LYNX1
• Synonyms: SLURP2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC218661 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  RCATGACGCCCCTGCTCACCCTGATCCTGGTGGTCCTCATGGGCTTACCTCTGGCCCAGGCCTTGGACTG
  CCACGTGTGTGCCTACAACGGAGACAACTGCTTCAACCCCATGCGCTGCCCGGCTATGGTTGCCTACTGC
  ATGACCACGCGCACCTACTACACCCCCACCAGGATGAAGGTCAGTAAGTCCTGCGTGCCCCGCTGCTTCG
  AGACTGTGTATGATGGCTACTCCAAGC
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC218661 protein sequence
  Red=Cloning site Green=Tags(s)
  
  X*RPCSP*SWWSSWAYLWPRPWTATCVPTTETTASTPCAARLWLPTA*PRAPTTPPPG*RSVSPACPAAS
  RLCMMATPS
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_177457
• ORF Size: 1245 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_177457.1, NM_177457.2, NM_177457.3, NM_177457.4, NP_803252.1
• RefSeq Size: 4967
• RefSeq ORF: 351
• Locus ID: 66004
• Protein Families: Druggable Genome
• MW: 8.8 kDa
• Gene Summary: This gene encodes a GPI-anchored, cell membrane bound member of the Ly6/uPAR (LU) superfamily of proteins containing the unique three-finger LU domain. This protein interacts with nicotinic acetylcholine receptors (nAChRs), and is thought to function as a modulator of nAChR activity to prevent excessive excitation. Alternatively spliced transcript variants have been found for this gene. Read-through transcription between this gene and the neighboring downstream gene (SLURP2) generates naturally-occurring transcripts (LYNX1-SLURP2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq, Sep 2017]