RAB27A (NM_004580) Human Tagged ORF Clone

CAT#: RC220897

RAB27A (Myc-DDK-tagged)-Human RAB27A, member RAS oncogene family (RAB27A), transcript variant 1


  "NM_004580" in other vectors (4)

Reconstitution Protocol

USD 420.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "RAB27A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RAB27A
Synonyms GS2; HsT18676; RAB27; RAM
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220897 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGATGGAGATTATGATTACCTCATCAAGTTTTTAGCTTTGGGAGACTCTGGTGTAGGGAAGACCA
GTGTACTTTACCAATATACAGATGGTAAATTTAACTCCAAATTTATCACAACAGTGGGCATTGATTTCAG
GGAAAAAAGAGTGGTGTACAGAGCCAGTGGGCCGGATGGAGCCACTGGCAGAGGCCAGAGAATCCACCTG
CAGTTATGGGACACAGCAGGGCAGGAGAGGTTTCGTAGCTTAACGACAGCGTTCTTCAGAGATGCTATGG
GTTTTCTTCTACTTTTTGATCTGACAAATGAGCAAAGTTTCCTCAATGTCAGAAACTGGATAAGCCAGCT
ACAGATGCATGCATATTGTGAAAACCCAGATATAGTGCTGTGTGGAAACAAGAGTGATCTGGAGGACCAG
AGAGTAGTGAAAGAGGAGGAAGCCATAGCACTCGCAGAGAAATATGGAATCCCCTACTTTGAAACTAGTG
CTGCCAATGGGACAAACATAAGCCAAGCAATTGAGATGCTTCTGGACCTGATAATGAAGCGAATGGAACG
GTGTGTGGACAAGTCCTGGATTCCTGAAGGAGTGGTGCGATCAAATGGTCATGCCTCTACGGATCAGTTA
AGTGAAGAAAAGGAGAAAGGGGCATGTGGCTGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220897 protein sequence
Red=Cloning site Green=Tags(s)

MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHL
QLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ
RVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQL
SEEKEKGACGC

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004580
ORF Size 663 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004580.1, NM_004580.2, NM_004580.3, NM_004580.4, NP_004571.2
RefSeq Size 3474 bp
RefSeq ORF 666 bp
Locus ID 5873
Cytogenetics 15q21.3
Domains ras, RAN, RAS, RHO, RAB
Protein Families Druggable Genome
MW 24.9 kDa
Gene Summary 'The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscelli syndrome type 2. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.