TAC4 (NM_001077503) Human Tagged ORF Clone

CAT#: RC222319

TAC4 (Myc-DDK-tagged)-Human tachykinin 4 (hemokinin) (TAC4), transcript variant beta

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: TAC4
• Synonyms: EK; HK-1; HK1; PPT-C
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC222319 representing NM_001077503
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCTGCCTTGCCTCGCCCTGCTTCTCCTGATGGAGCTGTCCGTGTGCACTGTGGCAGGTGATGGTGGAG
  AGGAACAGACACTCAGCACTGAAGCAGAGACCTGGGAAGGCGCTGGCCCCAGCATTCAGCTCCAGCTGCA
  GGAGGTGAAGACGGGCAAGGCAAGCCAGTTCTTTGGGCTGATGGGGAAGCGAGTGGGAGCATATCAGCTG
  GAACACACGTTCCAGGGCCTCCTGGGCAAGAGAAGCCTGTTCACAGAAGGCAGAGAGGATGAGGCCCAAG
  GTTCAGAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC222319 representing NM_001077503
  Red=Cloning site Green=Tags(s)
  
  MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGAYQL
  EHTFQGLLGKRSLFTEGREDEAQGSE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001077503
• ORF Size: 288 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001077503.1, NP_001070971.1
• RefSeq Size: 624
• RefSeq ORF: 291
• Locus ID: 255061
• MW: 10.2 kDa
• Gene Summary: This gene is a member of the tachykinin family of neurotransmitter-encoding genes. Tachykinin proteins are cleaved into small, secreted peptides that activate members of a family of receptor proteins. The products of this gene preferentially activate tachykinin receptor 1, and are thought to regulate peripheral endocrine and paracrine functions including blood pressure, the immune system, and endocrine gland secretion. The products of this gene lack a dibasic cleavage site found in other tachykinin proteins. Consequently, the nature of the cleavage products generated in vivo remains to be determined. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]