DPPA5 (NM_001025290) Human Tagged ORF Clone
CAT#: RC222509
DPPA5 (Myc-DDK-tagged)-Human developmental pluripotency associated 5 (DPPA5)
"NM_001025290" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | DPPA5 |
Synonyms | ESG1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC222509 representing NM_001025290
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGAACTCTCCCGGCACGTAGACATATCCCGCCGTGGGTGAAAGTTCCCGAAGACCTGAAAGATCCAG AGGTGTTCCAGGTCCAGACGCGGCTGCTGAAAGCCATTTTCGGCCCGGACGGATCTCGAATCCCTTACAT CGAGCAGGTGAGCAAGGCCATGCTCGAGCTGAAGGCTCTGGAGTCTTCAGACCTCACCGAGGTCGTGGTT TACGGCTCCTATTTGTACAAGCTCCGGACCAAGTGGATGCTCCAGTCCATGGCTGAGTGGCACCGCCAGC GCCAGGAGCGAGGGATGCTCAAACTTGCCGAAGCCATGAATGCCCTCGAACTAGGCCCTTGGATGAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC222509 representing NM_001025290
Red=Cloning site Green=Tags(s) MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001025290 |
ORF Size | 348 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001025290.1, NM_001025290.2, NP_001020461.1 |
RefSeq Size | 612 bp |
RefSeq ORF | 351 bp |
Locus ID | 340168 |
Cytogenetics | 6q13 |
MW | 13.3 kDa |
Gene Summary | This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. [provided by RefSeq, Dec 2010] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC302388 | DPPA5 (untagged)-Human developmental pluripotency associated 5 (DPPA5) |
USD 420.00 |
|
RG222509 | DPPA5 (GFP-tagged) - Human developmental pluripotency associated 5 (DPPA5) |
USD 570.00 |
|
RC222509L1 | Lenti ORF clone of Human developmental pluripotency associated 5 (DPPA5), Myc-DDK-tagged |
USD 888.00 |
|
RC222509L2 | Lenti ORF clone of Human developmental pluripotency associated 5 (DPPA5), mGFP tagged |
USD 720.00 |
|
RC222509L3 | Lenti ORF clone of Human developmental pluripotency associated 5 (DPPA5), Myc-DDK-tagged |
USD 720.00 |
|
RC222509L4 | Lenti ORF clone of Human developmental pluripotency associated 5 (DPPA5), mGFP tagged |
USD 720.00 |
{0} Product Review(s)
Be the first one to submit a review