HSFY1 (HSFY2) (NM_001001877) Human Tagged ORF Clone

CAT#: RC223109

HSFY2 (Myc-DDK-tagged)-Human heat shock transcription factor, Y linked 2 (HSFY2), transcript variant 2

Product Images

Western blot validation of overexpression lysate (Cat# LY424259) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC223109 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: HSFY2
• Synonyms: HSF2L; HSFY
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC223109 representing NM_001001877
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCACATGTTTCTTCAGAAACTCAAGATGTTTCCCCCAAAGATGAATTAACTGCTTCAGAAGCCTCCA
  CTAGGTCTCCATTGTGTGAACACACCTTCCCTGGGGACTCAGACTTACGGTCAATGATTGAAGAACATGC
  TTTTCAGGTTTTGTCACAAGGATCCTTGTTAGAAAGTCCAAGTTACACAGTTTGTGTCTCTGAGCCAGAT
  AAAGATGATGATTTTCTTTCTCTGAACTTTCCCAGGAAACTTTGGAAAATAGTGGAAAGTGACCAATTCA
  AGTCTATTTCATGGGATGAGAATGGAACTTGCATAGTGATTAATGAAGAACTCTTCAAGAAAGAAATTTT
  GGAAACAAAGGCTCCTTACAGAATATTTCAAACTGATGCTATCAAAAGTTTTGTTCGACAGCTCAACCTT
  TATGGATTTAGTAAAATTCAACAGAATTTTCAAAGATCTGCCTTTCTAGCCACCTTTCTGTCAGAAGAGA
  AAGAATCGTCTGTCTTAAGCAAGATACGCTTCACCAAAATGAAACTTTCCAGATCTTCAACTTATGAAAA
  CAGGTATTTATGTTGCAACTTACATTTAAAAGATGAGTCGAATTACTCA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC223109 representing NM_001001877
  Red=Cloning site Green=Tags(s)
  
  MAHVSSETQDVSPKDELTASEASTRSPLCEHTFPGDSDLRSMIEEHAFQVLSQGSLLESPSYTVCVSEPD
  KDDDFLSLNFPRKLWKIVESDQFKSISWDENGTCIVINEELFKKEILETKAPYRIFQTDAIKSFVRQLNL
  YGFSKIQQNFQRSAFLATFLSEEKESSVLSKIRFTKMKLSRSSTYENRYLCCNLHLKDESNYS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001001877
• ORF Size: 609 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001001877.1, NP_001001877.1
• RefSeq Size: 1038 bp
• RefSeq ORF: 612 bp
• Locus ID: 159119
• Cytogenetics: Yq11.222
• Protein Families: Transcription Factors
• MW: 23.2 kDa
• Gene Summary: This gene encodes a member of the heat shock factor (HSF) family of transcriptional activators for heat shock proteins. This gene is a candidate gene for azoospermia, since it localizes to a region of chromosome Y that is sometimes deleted in infertile males. The genome has two identical copies of this gene within a palindromic region; this record represents the more telomeric copy. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]