Kallikrein 15 (KLK15) (NM_138563) Human Tagged ORF Clone

CAT#: RC223726

KLK15 (Myc-DDK-tagged)-Human kallikrein-related peptidase 15 (KLK15), transcript variant 2

Product Images

Western blot validation of overexpression lysate (Cat# LY408579) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC223726 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: KLK15
• Synonyms: ACO; HSRNASPH
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC223726 representing NM_138563
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTGGCTTCTCCTCACTCTCTCCTTCCTGCTGGCATCCACAGCAGCCCAGGATGGTGACAAGTTGCTGG
  AAGGTGACGAGTGTGCACCCCACTCCCAGCCATGGCAAGTGGCTCTCTACGAGCGTGGACGCTTTAACTG
  TGGCGCTTCCCTCATCTCCCCACACTGGGTGCTGTCTGCGGCCCACTGCCAAAGCCGCTTCATGAGAGTG
  CGCCTGGGAGAGCACAACCTGCGCAAGCGCGATGGCCCAGAGCAACTACGGACCACGTCTCGGGTCATTC
  CACACCCGCGCTACGAAGCGCGCAGCCACCGCAACGACATCATGTTGCTGCGCCTAGTCCAGCCCGCACG
  CCTGAACCCCCAGGTGCGCCCCGCGGTGCTACCCACGCGTTGCCCCCACCCGGGGGAGGCCTGTGTGGTG
  TCTGGCTGGGGCCTGGTGTCCCACAACGAGCCTGGGACCGCTGGGAGCCCCCGGTCACAAGGG
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC223726 representing NM_138563
  Red=Cloning site Green=Tags(s)
  
  MWLLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRFMRV
  RLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPGEACVV
  SGWGLVSHNEPGTAGSPRSQG
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-RsrII Cloning Scheme for this gene Plasmid Map
• ACCN: NM_138563
• ORF Size: 483 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_138563.1, NP_612630.1
• RefSeq Size: 1172
• RefSeq ORF: 485
• Locus ID: 55554
• Protein Families: Druggable Genome, Protease, Secreted Protein
• MW: 16.2 kDa
• Gene Summary: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. In prostate cancer, this gene has increased expression, which indicates its possible use as a diagnostic or prognostic marker for prostate cancer. The gene contains multiple polyadenylation sites and alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]