HLA-DQA2 (NM_020056) Human Tagged ORF Clone

CAT#: RC223979

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2)

Product Images

Western blot validation of overexpression lysate (Cat# LY412649) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC223979 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: HLA-DQA2
• Synonyms: DC-alpha; DX-ALPHA; HLA-DCA; HLA-DXA; HLADQA2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC223979 representing NM_020056
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGATCCTAAACAAAGCTCTGCTGCTGGGGGCCCTCGCCCTGACTGCCGTGATGAGCCCCTGTGGAGGTG
  AAGACATTGTGGCTGACCATGTTGCCTCCTATGGTGTGAACTTCTACCAGTCTCACGGTCCCTCTGGCCA
  GTACACCCATGAATTTGATGGAGACGAGGAGTTCTACGTGGACCTGGAGACGAAAGAGACTGTCTGGCAG
  TTGCCTATGTTTAGCAAATTTATAAGTTTTGACCCGCAGAGTGCACTGAGAAATATGGCTGTGGGAAAAC
  ACACCTTGGAATTCATGATGAGACAGTCCAACTCTACCGCTGCCACCAATGAGGTTCCTGAGGTCACAGT
  GTTTTCCAAGTTTCCTGTGACGCTGGGTCAGCCCAACACCCTCATCTGTCTTGTGGACAACATCTTTCCT
  CCTGTGGTCAACATCACCTGGCTGAGCAATGGGCACTCAGTCACAGAAGGTGTTTCTGAGACCAGCTTCC
  TCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCTTCCTCCCTTCTGCTGATGAGATTTA
  TGACTGCAAGGTGGAGCACTGGGGCCTGGACGAGCCTCTTCTGAAACACTGGGAGCCTGAGATTCCAGCC
  CCTATGTCAGAGCTCACAGAGACTTTGGTCTGCGCCCTGGGGTTGTCTGTGGGCCTCATGGGCATTGTGG
  TGGGCACTGTCTTCATCATCCAAGGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCTCTTA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC223979 representing NM_020056
  Red=Cloning site Green=Tags(s)
  
  MILNKALLLGALALTAVMSPCGGEDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQ
  LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSKFPVTLGQPNTLICLVDNIFP
  PVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPA
  PMSELTETLVCALGLSVGLMGIVVGTVFIIQGLRSVGASRHQGLL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_020056
• ORF Size: 765 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_020056.1, NM_020056.2, NM_020056.3, NM_020056.4, NP_064440.1
• RefSeq Size: 1709 bp
• RefSeq ORF: 768 bp
• Locus ID: 3118
• Cytogenetics: 6p21.32
• Domains: MHC_II_alpha, ig, IGc1
• Protein Families: Transmembrane
• Protein Pathways: Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis
• MW: 27.9 kDa
• Gene Summary: 'This gene belongs to the HLA class II alpha chain family. The encoded protein forms a heterodimer with a class II beta chain. It is located in intracellular vesicles and plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells, macrophages) and are used to present antigenic peptides on the cell surface to be recognized by CD4 T-cells. [provided by RefSeq, Jun 2010]'