ZNF673 (KRBOX4) (NM_001129899) Human Tagged ORF Clone

CAT#: RC225017

  • TrueORF®

KRBOX4 (Myc-DDK-tagged)-Human zinc finger family member 673 (ZNF673), transcript variant 3


  "NM_001129899" in other vectors (4)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "KRBOX4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KRBOX4
Synonyms ZNF673
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC225017 representing NM_001129899
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCATGTCCCAGGAATCATTGACCTTCAAGGACGTGTTTGTGGACTTCACCCTGGAGGAGTGGCAGC
AACTGGACTCTGCCCAGAAGAACCTCTACAGGGATGTCATGCTTGAGAACTACAGCCACCTGGTGTCCGT
GGGGTATCTAGTTGCGAAGCCAGATGTGATCTTCAGGTTGGGACCAGGTGAAGAGTCCTGGATGGCAGAT
GGGGGGACCCCGGTACGGACCTGTGCAGGTGAGGACAGGCCAGATGTATCCATTTTTGCCTCATGTATTT
TGAAGTGCTGTTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC225017 representing NM_001129899
Red=Cloning site Green=Tags(s)

MAMSQESLTFKDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGYLVAKPDVIFRLGPGEESWMAD
GGTPVRTCAGEDRPDVSIFASCILKCCY

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001129899
ORF Size 294 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001129899.1, NP_001123371.1
RefSeq ORF 297
Locus ID 55634
Protein Families Transcription Factors
MW 10.9 kDa
Gene Summary This encodes a zinc finger protein with an N-terminal KRAB (Kruppel-associated) domain found in transcriptional repressors. This gene is located in a region of the X chromosome thought to be involved in nonsyndromic X-linked cognitive disability. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.